(data stored in ACNUC7421 zone)

EMBL: CP000821.PE84

CP000821.PE84        Location/Qualifiers
FT   CDS             92434..92703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0084"
FT                   /product="export protein FliQ, family 3"
FT                   /note="KEGG: sbl:Sbal_3985 export protein FliQ, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34697"
FT                   /db_xref="GOA:A8FPC4"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC4"
FT                   /protein_id="ABV34697.1"
FT                   /translation="MEVNELTSIFSDAIYLVVAMVGVLVVPSLLVGLIIAVFQAATQVN
FT                   EQTLSFLPRLVLTLLMVLFSGQWLLQQISDLFDRLFMNIPHIIG"
     MEVNELTSIF SDAIYLVVAM VGVLVVPSLL VGLIIAVFQA ATQVNEQTLS FLPRLVLTLL        60
     MVLFSGQWLL QQISDLFDRL FMNIPHIIG                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page