(data stored in ACNUC7421 zone)

EMBL: CP000821.PE85

CP000821.PE85        Location/Qualifiers
FT   CDS             92706..93479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0085"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="KEGG: sbl:Sbal_3986 flagellar biosynthetic protein
FT                   FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34698"
FT                   /db_xref="GOA:A8FPC5"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC5"
FT                   /protein_id="ABV34698.1"
FT                   /translation="MLSLTSAQLSSFIGIFWWPFFRIMGAFMVMPFLSSSYIPVTVRVL
FT                   LALTISTLLAPMLPPLPSVDAISIGALFLAIEQLLVGFMLGLFLTIMIHVMTLLGAMMS
FT                   MQMGLAMAVMNDPANGSSNPILGQWFLLYGTLLFLALDGHLVAIGVLVDSFRLWPIGSG
FT                   VLDLPLMGLVSRFAWIFASALMLALPSILAMLMVNITFGVLSRAAPSLNVFALGFPMSM
FT                   LMGLLCVMLSFSGLPTRYSDICLDALEAMYQFIGG"
     MLSLTSAQLS SFIGIFWWPF FRIMGAFMVM PFLSSSYIPV TVRVLLALTI STLLAPMLPP        60
     LPSVDAISIG ALFLAIEQLL VGFMLGLFLT IMIHVMTLLG AMMSMQMGLA MAVMNDPANG       120
     SSNPILGQWF LLYGTLLFLA LDGHLVAIGV LVDSFRLWPI GSGVLDLPLM GLVSRFAWIF       180
     ASALMLALPS ILAMLMVNIT FGVLSRAAPS LNVFALGFPM SMLMGLLCVM LSFSGLPTRY       240
     SDICLDALEA MYQFIGG                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page