(data stored in ACNUC7421 zone)

EMBL: CP000821.PE86

CP000821.PE86        Location/Qualifiers
FT   CDS             93496..94626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0086"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="KEGG: sdn:Sden_3667 flagellar biosynthetic protein
FT                   FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34699"
FT                   /db_xref="GOA:A8FPC6"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC6"
FT                   /protein_id="ABV34699.1"
FT                   /translation="MSKDTGQSKTEKATPQKLKKAQDQGQVPRSKDLAATALIIGCSLM
FT                   LTASADWFATRVARVAQYNMSLTKAELDEPGMMMSHLGTSLVEILNILGPIIVLIAVLA
FT                   MVAGSMPGGPVFNFKNAAFKYSRIDPIAGIGRMFSMKSLVELVKSILKIVLLIGIMFTF
FT                   LEHNLQSLLGYSQLPIDEAVRKGIDILSLGMLYLGIGMLVITFIDVPYQYWHHHNELKM
FT                   SRQDVKDEHKQQEGKPEIKAKIRQLQQRIGRSRADVAIPQADVLLVNPNHYAVALKYDV
FT                   EKADAPYVLTKGTDELALYMRQIAKHHDVEVIELPPLARAIYYSTQVEQQIPAALFIAI
FT                   AHVLSYVLQIKAARQGKQQRPDPLPNFFIPPHLRRD"
     MSKDTGQSKT EKATPQKLKK AQDQGQVPRS KDLAATALII GCSLMLTASA DWFATRVARV        60
     AQYNMSLTKA ELDEPGMMMS HLGTSLVEIL NILGPIIVLI AVLAMVAGSM PGGPVFNFKN       120
     AAFKYSRIDP IAGIGRMFSM KSLVELVKSI LKIVLLIGIM FTFLEHNLQS LLGYSQLPID       180
     EAVRKGIDIL SLGMLYLGIG MLVITFIDVP YQYWHHHNEL KMSRQDVKDE HKQQEGKPEI       240
     KAKIRQLQQR IGRSRADVAI PQADVLLVNP NHYAVALKYD VEKADAPYVL TKGTDELALY       300
     MRQIAKHHDV EVIELPPLAR AIYYSTQVEQ QIPAALFIAI AHVLSYVLQI KAARQGKQQR       360
     PDPLPNFFIP PHLRRD                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page