(data stored in ACNUC7421 zone)

EMBL: CP000821.PE87

CP000821.PE87        Location/Qualifiers
FT   CDS             94830..96911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0087"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="KEGG: shw:Sputw3181_0454 flagellar biosynthesis
FT                   protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34700"
FT                   /db_xref="GOA:A8FPC7"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC7"
FT                   /protein_id="ABV34700.1"
FT                   /translation="MNWLSRTFAGNRSYIGIPIMLLAILAMVILPLPPWLLDILFTFNI
FT                   VLAVMVLLVSVSIRRPIDFSVFPTVLLLATLMRLTLNVASTRVVLIEGHQGGDAAGRVI
FT                   QAFGEVVINGNYVVGGVIFLILMIINFVVITKGGERISEVSARFTLDALPGKQMAIDAD
FT                   LNAGVLSQEQARVRRQDVAREADFYGSMDGASKFVRGDAIAGLMILAINILGGIAIGVF
FT                   MHGLSAGEAFRTYALLTIGDGLVAQIPSLLLATAAAIIVTRVSDAEEMPTQLSKQLLAN
FT                   PKTLATAAAVMTILGLVPGMPAFVFLSFAALLGFAAWKQSQGRSVQPETEVEEQLEKSL
FT                   SEPSAPSWDALPFTDLIEVRLGYRLVHLVERSKGAELQKRLTGIRRTLSEQAGFLLAEV
FT                   RVRDNLALAPNAYQINLMGNPVVTAELEPERMMAIKSGPVFGDIDGVITKEPAYNMDAT
FT                   WIEPELKAKALNLGYSVVDNATVIATHVSKLIRESLPDMLQHDDVIALSDRLAKQSPKL
FT                   AESLSTALTPIQQLKVYRLLLKEQVSLKDIRTIATTLLDCSENSKDPVLLAADVRCALR
FT                   NSILHSIAGSAPQINVLTLAPELEQTLMTALNQSQQQGKVALDSFPVEPQLLAQLQQKM
FT                   PQILADAKEQGHSPMLLVSPQLRPILARYALAFARGLHVLSYNEIPETRELMVAGQLG"
     MNWLSRTFAG NRSYIGIPIM LLAILAMVIL PLPPWLLDIL FTFNIVLAVM VLLVSVSIRR        60
     PIDFSVFPTV LLLATLMRLT LNVASTRVVL IEGHQGGDAA GRVIQAFGEV VINGNYVVGG       120
     VIFLILMIIN FVVITKGGER ISEVSARFTL DALPGKQMAI DADLNAGVLS QEQARVRRQD       180
     VAREADFYGS MDGASKFVRG DAIAGLMILA INILGGIAIG VFMHGLSAGE AFRTYALLTI       240
     GDGLVAQIPS LLLATAAAII VTRVSDAEEM PTQLSKQLLA NPKTLATAAA VMTILGLVPG       300
     MPAFVFLSFA ALLGFAAWKQ SQGRSVQPET EVEEQLEKSL SEPSAPSWDA LPFTDLIEVR       360
     LGYRLVHLVE RSKGAELQKR LTGIRRTLSE QAGFLLAEVR VRDNLALAPN AYQINLMGNP       420
     VVTAELEPER MMAIKSGPVF GDIDGVITKE PAYNMDATWI EPELKAKALN LGYSVVDNAT       480
     VIATHVSKLI RESLPDMLQH DDVIALSDRL AKQSPKLAES LSTALTPIQQ LKVYRLLLKE       540
     QVSLKDIRTI ATTLLDCSEN SKDPVLLAAD VRCALRNSIL HSIAGSAPQI NVLTLAPELE       600
     QTLMTALNQS QQQGKVALDS FPVEPQLLAQ LQQKMPQILA DAKEQGHSPM LLVSPQLRPI       660
     LARYALAFAR GLHVLSYNEI PETRELMVAG QLG                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page