(data stored in ACNUC7421 zone)

EMBL: CP000821.PE89

CP000821.PE89        Location/Qualifiers
FT   CDS             complement(98169..99968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0089"
FT                   /product="protein of unknown function DUF885"
FT                   /note="KEGG: sbl:Sbal_0045 protein of unknown function
FT                   DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34702"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC9"
FT                   /protein_id="ABV34702.1"
FT                   /translation="MYKILVPSLLAFSLSACQLNLVNTDQPQAPDIPVETQASTQLQGL
FT                   IEKSWLITLDASPDFAYSQGNLDKAGQLTDLSPLALANLNKRRQVILYSLMALDRGPLT
FT                   KEEKINAQILQDQLQNNVDLYRYKDHYLPISSESGFHAYIASIAKARFATERDYGNYIA
FT                   KLKALPTYFAQQTHWLQQGLDSGITPPKITLKGFEESISAFIVPVEQSGYFKPFTQYPK
FT                   HFTDSQKTALTQEGHDLVQNTVLPLYRQFYDFMTLSYIPGARTSIATASLPDGEAFYEN
FT                   RVRYYTTLNMNSDQVHQLGLKEVKRIRAEMETIINEVGFKGSFADFLHFLRTDPQFYPT
FT                   TAEELLKEAAYIAKKADAMLPKYFGKLPRTPYGIQEVPAEIAPKYTTGRYSGSNRDDEP
FT                   GYYWVNTYALDKRPLYEMEALTLHEAVPGHHLQISLNTELTSLPNFRRYSYISAFGEGW
FT                   GLYSEYLGLEAGFYQDPYSNFGRLTYEMWRAARLVVDTGMHAKGWSRQQALDFMASNTA
FT                   LSMHNVTTEIDRYISWPGQALSYKIGELTIKRLRAKAEDALGEEFDIRAFHDAVLENGS
FT                   VPMQVLEQQIDDFISAQKAIKGS"
     MYKILVPSLL AFSLSACQLN LVNTDQPQAP DIPVETQAST QLQGLIEKSW LITLDASPDF        60
     AYSQGNLDKA GQLTDLSPLA LANLNKRRQV ILYSLMALDR GPLTKEEKIN AQILQDQLQN       120
     NVDLYRYKDH YLPISSESGF HAYIASIAKA RFATERDYGN YIAKLKALPT YFAQQTHWLQ       180
     QGLDSGITPP KITLKGFEES ISAFIVPVEQ SGYFKPFTQY PKHFTDSQKT ALTQEGHDLV       240
     QNTVLPLYRQ FYDFMTLSYI PGARTSIATA SLPDGEAFYE NRVRYYTTLN MNSDQVHQLG       300
     LKEVKRIRAE METIINEVGF KGSFADFLHF LRTDPQFYPT TAEELLKEAA YIAKKADAML       360
     PKYFGKLPRT PYGIQEVPAE IAPKYTTGRY SGSNRDDEPG YYWVNTYALD KRPLYEMEAL       420
     TLHEAVPGHH LQISLNTELT SLPNFRRYSY ISAFGEGWGL YSEYLGLEAG FYQDPYSNFG       480
     RLTYEMWRAA RLVVDTGMHA KGWSRQQALD FMASNTALSM HNVTTEIDRY ISWPGQALSY       540
     KIGELTIKRL RAKAEDALGE EFDIRAFHDA VLENGSVPMQ VLEQQIDDFI SAQKAIKGS        599
//

If you have problems or comments...

PBIL Back to PBIL home page