(data stored in ACNUC7421 zone)

EMBL: CP000821.PE9

CP000821.PE9         Location/Qualifiers
FT   CDS             8689..11130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0009"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: slo:Shew_0004 DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34622"
FT                   /db_xref="GOA:A8FP49"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP49"
FT                   /protein_id="ABV34622.1"
FT                   /translation="MNNRRENNMSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGL
FT                   HHMVFEVVDNSIDEALAGHCNDVIITIHADGSVSVKDDGRGIPVAIHPEEGISAAEVIM
FT                   TVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSHKLQLTIRRDGKLYEQFYTHGEPDEPI
FT                   KAIGDATNTGTEIRFWPSTDTFTDVLFHFDILAKRVRELSFLNSGVGVRLVDERDNRDE
FT                   FFKYDGGISAFVDYLNVNKTPVNKEVFHFIQERDDGITVEVAMQWNDGFQENIFCFTNN
FT                   IPQRDGGTHLAGFRGALTRNLNTYMEREGYNKKGKTGATGDDAREGLTAVISVKVPDPK
FT                   FSSQTKDKLVSSEVKSAVEQTMGEQLGDYLMEHPNEAKLIVGKIIDAARAREAARKARE
FT                   MTRRKGALDLGGLPGKLADCQEKDPALSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGK
FT                   ILNVEKARFDKMLSSQEVATLITALGCGIGRDEYDPDKTRYHNIVIMTDADVDGSHIRT
FT                   LLLTFFFRQMPELIERGFVYIAQPPLYKVKKGKQEQYLKDDPALTEFLTNLALDGGEIH
FT                   ASANAPAMSGAPLEKLVYQYREVEAIFDRLDQRYPLMLTERMLYHPALSNDVLADEAKV
FT                   QQWCDAYVADLAEKESGGYIFSGEAFLEPERQVYLPKITIRKHGIDTHYLFSYDFLQSS
FT                   DYERMAKLATALDGLIEEGGYVKRGERLKEVSSFVEALDWLMNDSRRGLYIQRYKGLGE
FT                   MNPEQLWETTMDPESRRMLVVTIEDAIAADQLFTCLMGDQVEPRREFIESNALNVANLD
FT                   V"
     MNNRRENNMS ENSYDSSSIK VLKGLDAVRK RPGMYIGDTD DGTGLHHMVF EVVDNSIDEA        60
     LAGHCNDVII TIHADGSVSV KDDGRGIPVA IHPEEGISAA EVIMTVLHAG GKFDDNSYKV       120
     SGGLHGVGVS VVNALSHKLQ LTIRRDGKLY EQFYTHGEPD EPIKAIGDAT NTGTEIRFWP       180
     STDTFTDVLF HFDILAKRVR ELSFLNSGVG VRLVDERDNR DEFFKYDGGI SAFVDYLNVN       240
     KTPVNKEVFH FIQERDDGIT VEVAMQWNDG FQENIFCFTN NIPQRDGGTH LAGFRGALTR       300
     NLNTYMEREG YNKKGKTGAT GDDAREGLTA VISVKVPDPK FSSQTKDKLV SSEVKSAVEQ       360
     TMGEQLGDYL MEHPNEAKLI VGKIIDAARA REAARKAREM TRRKGALDLG GLPGKLADCQ       420
     EKDPALSEIY IVEGDSAGGS AKQGRNRKNQ AILPLKGKIL NVEKARFDKM LSSQEVATLI       480
     TALGCGIGRD EYDPDKTRYH NIVIMTDADV DGSHIRTLLL TFFFRQMPEL IERGFVYIAQ       540
     PPLYKVKKGK QEQYLKDDPA LTEFLTNLAL DGGEIHASAN APAMSGAPLE KLVYQYREVE       600
     AIFDRLDQRY PLMLTERMLY HPALSNDVLA DEAKVQQWCD AYVADLAEKE SGGYIFSGEA       660
     FLEPERQVYL PKITIRKHGI DTHYLFSYDF LQSSDYERMA KLATALDGLI EEGGYVKRGE       720
     RLKEVSSFVE ALDWLMNDSR RGLYIQRYKG LGEMNPEQLW ETTMDPESRR MLVVTIEDAI       780
     AADQLFTCLM GDQVEPRREF IESNALNVAN LDV                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page