(data stored in ACNUC7421 zone)

EMBL: CP000821.PE91

CP000821.PE91        Location/Qualifiers
FT   CDS             complement(101794..102273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34704"
FT                   /db_xref="GOA:A8FPD1"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD1"
FT                   /protein_id="ABV34704.1"
FT                   /translation="MTTALLILGFIIVMTLAAYATALLLKLRKQTAQRLKRQQELDEIN
FT                   RARVDEHLDSIRYIATAMLEERCELSEGVMRIAKLFGILSMSEQVAPQFPAIFKHFEII
FT                   EEHPIMAERKQLEKKQRMKLDFARMRSEAELETAILEEAKQLVTYSQTEIPTHLH"
     MTTALLILGF IIVMTLAAYA TALLLKLRKQ TAQRLKRQQE LDEINRARVD EHLDSIRYIA        60
     TAMLEERCEL SEGVMRIAKL FGILSMSEQV APQFPAIFKH FEIIEEHPIM AERKQLEKKQ       120
     RMKLDFARMR SEAELETAIL EEAKQLVTYS QTEIPTHLH                              159
//

If you have problems or comments...

PBIL Back to PBIL home page