(data stored in ACNUC7421 zone)

EMBL: CP000821.PE92

CP000821.PE92        Location/Qualifiers
FT   CDS             complement(102406..102942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34705"
FT                   /db_xref="GOA:A8FPD2"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD2"
FT                   /protein_id="ABV34705.1"
FT                   /translation="MAHSKKSRKTDQNAPKLAPRSKKNERVLAGKKKETGNKAGSRHNS
FT                   NLVGGTQGSAAQKKDPRHGSKTAVKLDLPGQTIAPKKEKGPKLTDEQRLFKLEEDPRLN
FT                   QLLDMLEEGKDLNEEDQKWLNKQLNTIESLMERLGITEQDDLDHAMKSAVASSDDDLLD
FT                   KFESGADLLKDYQDK"
     MAHSKKSRKT DQNAPKLAPR SKKNERVLAG KKKETGNKAG SRHNSNLVGG TQGSAAQKKD        60
     PRHGSKTAVK LDLPGQTIAP KKEKGPKLTD EQRLFKLEED PRLNQLLDML EEGKDLNEED       120
     QKWLNKQLNT IESLMERLGI TEQDDLDHAM KSAVASSDDD LLDKFESGAD LLKDYQDK         178
//

If you have problems or comments...

PBIL Back to PBIL home page