(data stored in ACNUC7421 zone)

EMBL: CP000821.PE93

CP000821.PE93        Location/Qualifiers
FT   CDS             complement(102991..103689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34706"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD3"
FT                   /protein_id="ABV34706.1"
FT                   /translation="MVNRSITMRRCPLCHNQHSSVFHQDRKRNMYLCDRCQLVFSDANS
FT                   HLPPPVEKRRYQQQVAKNQKPLKQFLMSLILQCEQQSTDPLIGLNFGRVAEPDTVLSVE
FT                   SHRHTLYQYDPYFAANHDLLKRQYDFICCYRVFEHFRFPFKEWSLLGKLLKPGAWLAIS
FT                   TKLLTELSAFDRWHHKNNLTHVSFYQHSTFEFLAQQAGFKLLFAANDLILVQKPSGSDI
FT                   KRDQSSLDDV"
     MVNRSITMRR CPLCHNQHSS VFHQDRKRNM YLCDRCQLVF SDANSHLPPP VEKRRYQQQV        60
     AKNQKPLKQF LMSLILQCEQ QSTDPLIGLN FGRVAEPDTV LSVESHRHTL YQYDPYFAAN       120
     HDLLKRQYDF ICCYRVFEHF RFPFKEWSLL GKLLKPGAWL AISTKLLTEL SAFDRWHHKN       180
     NLTHVSFYQH STFEFLAQQA GFKLLFAAND LILVQKPSGS DIKRDQSSLD DV               232
//

If you have problems or comments...

PBIL Back to PBIL home page