(data stored in ACNUC7421 zone)

EMBL: CP000821.PE95

CP000821.PE95        Location/Qualifiers
FT   CDS             105192..105854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0095"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /note="KEGG: slo:Shew_3715 GTP-binding protein,
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34708"
FT                   /db_xref="GOA:A8FPD5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPD5"
FT                   /protein_id="ABV34708.1"
FT                   /translation="MSESCIDFRKAKFLISAPDIAHLNEHLPGDAGVEIAFAGRSNAGK
FT                   SSALNLLTDQKSLARTSRTPGRTQLINIFELDENRRLVDLPGYGFAQVPLALKKKWQES
FT                   LGEYLQERQCLGGMVVLMDIRHPLKDLDMQMIAWALESEIPVLALLTKADKLKQSERMK
FT                   MVNEVRKHLGDFDDRVKVEPFSSLKGIGKAKVLGILNEWCHPQWLTDAIADAETEEE"
     MSESCIDFRK AKFLISAPDI AHLNEHLPGD AGVEIAFAGR SNAGKSSALN LLTDQKSLAR        60
     TSRTPGRTQL INIFELDENR RLVDLPGYGF AQVPLALKKK WQESLGEYLQ ERQCLGGMVV       120
     LMDIRHPLKD LDMQMIAWAL ESEIPVLALL TKADKLKQSE RMKMVNEVRK HLGDFDDRVK       180
     VEPFSSLKGI GKAKVLGILN EWCHPQWLTD AIADAETEEE                             220
//

If you have problems or comments...

PBIL Back to PBIL home page