(data stored in ACNUC7421 zone)

EMBL: CP000821.PE97

CP000821.PE97        Location/Qualifiers
FT   CDS             109761..110414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0097"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="KEGG: shn:Shewana3_4108 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34710"
FT                   /db_xref="GOA:A8FPD7"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD7"
FT                   /protein_id="ABV34710.1"
FT                   /translation="MKKIAVLLSGAGVFDGSEIHEAVLTMLALTKLGASYQCFAPDIEQ
FT                   MHVVNHLTGEVSAEESRNVLVESARIARGEIMATDRLDIEAFDALVIPGGFGAAKNLCN
FT                   FATNGSDCEISLEVSDFISEFADAKKPVGFICIAPIMIPLLYGEGVTGTIGNDVDTAQA
FT                   FNLMGGHHQEAVVQDIIVDEANKVVSTPAYMLAGNIAEANEGIEKLVKKVLEMV"
     MKKIAVLLSG AGVFDGSEIH EAVLTMLALT KLGASYQCFA PDIEQMHVVN HLTGEVSAEE        60
     SRNVLVESAR IARGEIMATD RLDIEAFDAL VIPGGFGAAK NLCNFATNGS DCEISLEVSD       120
     FISEFADAKK PVGFICIAPI MIPLLYGEGV TGTIGNDVDT AQAFNLMGGH HQEAVVQDII       180
     VDEANKVVST PAYMLAGNIA EANEGIEKLV KKVLEMV                                217
//

If you have problems or comments...

PBIL Back to PBIL home page