(data stored in ACNUC7421 zone)

EMBL: CP000821.PE98

CP000821.PE98        Location/Qualifiers
FT   CDS             complement(110846..111682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0098"
FT                   /product="rhomboid family protein"
FT                   /note="KEGG: slo:Shew_3712 rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34711"
FT                   /db_xref="GOA:A8FPD8"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD8"
FT                   /protein_id="ABV34711.1"
FT                   /translation="MIEIGRLPNERAAQALVDYLKGQNIDCKVIAAEQGVSLIVIHDQD
FT                   SVRAGIEFQRFIQNPYDEKYLQASWDNGDTNAKFDYGAPTLQLLTQFITGAGPLTLSIF
FT                   GVCILIFAGFNLGFANPIYEYLSFFNAVPGTELTDFWRVFTPSLLHFSALHIIFNLLWW
FT                   WYLGGKIENKIGISPLLTLLLVAGTLPNILQYFIGGPHFGGLSGVVYGVVGYTWIMGVK
FT                   RPEKGIGLPPALMGFLMLWLVFGFTDLFGLSIANGAHTGGLVVGLLQGLIDSKRRT"
     MIEIGRLPNE RAAQALVDYL KGQNIDCKVI AAEQGVSLIV IHDQDSVRAG IEFQRFIQNP        60
     YDEKYLQASW DNGDTNAKFD YGAPTLQLLT QFITGAGPLT LSIFGVCILI FAGFNLGFAN       120
     PIYEYLSFFN AVPGTELTDF WRVFTPSLLH FSALHIIFNL LWWWYLGGKI ENKIGISPLL       180
     TLLLVAGTLP NILQYFIGGP HFGGLSGVVY GVVGYTWIMG VKRPEKGIGL PPALMGFLML       240
     WLVFGFTDLF GLSIANGAHT GGLVVGLLQG LIDSKRRT                               278
//

If you have problems or comments...

PBIL Back to PBIL home page