(data stored in ACNUC7421 zone)

EMBL: CP000821.PE99

CP000821.PE99        Location/Qualifiers
FT   CDS             complement(111747..112055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0099"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: slo:Shew_3711 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34712"
FT                   /db_xref="GOA:A8FPD9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD9"
FT                   /protein_id="ABV34712.1"
FT                   /translation="MSSFQHFSVNQLIQLSESNPDIQIADIRDAASFESGHVEGAINLS
FT                   NENLANFIAEADMDLPLIVICYHGISSQSAAQYLVEQGFDHVYSLDGGYQAWREAHT"
     MSSFQHFSVN QLIQLSESNP DIQIADIRDA ASFESGHVEG AINLSNENLA NFIAEADMDL        60
     PLIVICYHGI SSQSAAQYLV EQGFDHVYSL DGGYQAWREA HT                          102
//

If you have problems or comments...

PBIL Back to PBIL home page