(data stored in ACNUC27125 zone)

EMBL: CP000828.ACKA

CP000828.ACKA        Location/Qualifiers
FT   CDS             426544..427740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="AM1_0445"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25501"
FT                   /db_xref="GOA:B0CB11"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CB11"
FT                   /protein_id="ABW25501.1"
FT                   /translation="MKILVLNAGSSSHKCCLYAIEGPLPDHPAPPLWEAQLDWHDPNHA
FT                   SLKVKTKRENLEEDLSDVSRADALSHLLTTLWHGPTQVIQMAQEINVVGHRVVHGGQDY
FT                   QSSVVVTSEVKTAIADLIPLAPNHNPANLEGIKLIEQLLGNVRQVAVFDTAFHSHLPEV
FT                   AAIYPGPYDWQQQGIRRYGFHGISHQYCTQRTAEILGRGVDRLIICHLGNGASLTAVKQ
FT                   GQSIDTSMGFTPLEGLMMGTRSGSIDPGILIHLMRQGYDADQLDHMLNKASGLKGISGV
FT                   SHDLREIEQAIAQDNAQAKLARDLYLHRLKACLGSMLMSLGGVDVLVFTGGIGEHSASV
FT                   RAETCEALAFLGLKLDPILNRKSPVDQDIAAVDSKVRVLVIKTQEDWAIAQSCYEQCC"
     MKILVLNAGS SSHKCCLYAI EGPLPDHPAP PLWEAQLDWH DPNHASLKVK TKRENLEEDL        60
     SDVSRADALS HLLTTLWHGP TQVIQMAQEI NVVGHRVVHG GQDYQSSVVV TSEVKTAIAD       120
     LIPLAPNHNP ANLEGIKLIE QLLGNVRQVA VFDTAFHSHL PEVAAIYPGP YDWQQQGIRR       180
     YGFHGISHQY CTQRTAEILG RGVDRLIICH LGNGASLTAV KQGQSIDTSM GFTPLEGLMM       240
     GTRSGSIDPG ILIHLMRQGY DADQLDHMLN KASGLKGISG VSHDLREIEQ AIAQDNAQAK       300
     LARDLYLHRL KACLGSMLMS LGGVDVLVFT GGIGEHSASV RAETCEALAF LGLKLDPILN       360
     RKSPVDQDIA AVDSKVRVLV IKTQEDWAIA QSCYEQCC                               398
//

If you have problems or comments...

PBIL Back to PBIL home page