(data stored in ACNUC27125 zone)

EMBL: CP000828.CORA

CP000828.CORA        Location/Qualifiers
FT   CDS             84449..85570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="AM1_0079"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25167"
FT                   /db_xref="GOA:B0C555"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:B0C555"
FT                   /protein_id="ABW25167.1"
FT                   /translation="MTNPLSDPLQQGYVDYFYDQAGSSPGTLTIDEDASPTRIVVIDYN
FT                   PHQARRIIVEQPEESADYLTTETVSWIDVQGLGDEDILRRLGQTFDLHPLVLEDVVNVP
FT                   QRQKVEDFDDQLLIIARMVLPHPEGVGFVSEQVSFILHQQALLTIQEEPFHDSFGPVRK
FT                   RIRLQKGLMRKMGADFLTYALLDAIIDGFFPVLELYGERLETLEDEILDNPTRETLNQV
FT                   HSLKRELMNLRRLSWSQRDALSALLREDSPLISQEVKVYLRDCYDHSIQILDMVETYRD
FT                   FAASLMDVYLSSVSNKMNEVMKVLTVISTIFIPLTFISGLYGMNFNPQVSPFNMPELSW
FT                   YWGYPAVIATMLLISGSLSYLFWRRGWFSKVSP"
     MTNPLSDPLQ QGYVDYFYDQ AGSSPGTLTI DEDASPTRIV VIDYNPHQAR RIIVEQPEES        60
     ADYLTTETVS WIDVQGLGDE DILRRLGQTF DLHPLVLEDV VNVPQRQKVE DFDDQLLIIA       120
     RMVLPHPEGV GFVSEQVSFI LHQQALLTIQ EEPFHDSFGP VRKRIRLQKG LMRKMGADFL       180
     TYALLDAIID GFFPVLELYG ERLETLEDEI LDNPTRETLN QVHSLKRELM NLRRLSWSQR       240
     DALSALLRED SPLISQEVKV YLRDCYDHSI QILDMVETYR DFAASLMDVY LSSVSNKMNE       300
     VMKVLTVIST IFIPLTFISG LYGMNFNPQV SPFNMPELSW YWGYPAVIAT MLLISGSLSY       360
     LFWRRGWFSK VSP                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page