(data stored in ACNUC27125 zone)

EMBL: CP000828.DNAJ

CP000828.DNAJ        Location/Qualifiers
FT   CDS             398585..399709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="AM1_0423"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25480"
FT                   /db_xref="GOA:B0CAZ0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CAZ0"
FT                   /protein_id="ABW25480.1"
FT                   /translation="MARDYYDILGVSRSADPDELKRSYRRLARKYHPDVNKEPGAEDKF
FT                   KEINKAYETLSDPQMRGRYDQFGEAGVSSAAGAGYQDFGDFGGFADIFETFFSGFGGSP
FT                   QSGRRRSGPARGEDLRFDLKLKFREAVFGGEQQIRISHLESCKTCEGTGAKPGTRPQTC
FT                   STCQGSGQVRRMTRTPLGNFTQVSVCPTCNGQGQVVTEKCDSCGGRGQNQVSKKLQIKI
FT                   PAGVDTGTRLRVSNEGDAGQKGGPPGDLYVYLFVQEDSEFRRDGTNVLSEFKISYLQAI
FT                   LGAQLPVKTVDGEETITIPAGTQPGTVLTLENHGVPRLGNPVSRGDHLITVIIDIPNRI
FT                   STEERELLVQLASIRAEQTGKGGIEGFLGGIFGR"
     MARDYYDILG VSRSADPDEL KRSYRRLARK YHPDVNKEPG AEDKFKEINK AYETLSDPQM        60
     RGRYDQFGEA GVSSAAGAGY QDFGDFGGFA DIFETFFSGF GGSPQSGRRR SGPARGEDLR       120
     FDLKLKFREA VFGGEQQIRI SHLESCKTCE GTGAKPGTRP QTCSTCQGSG QVRRMTRTPL       180
     GNFTQVSVCP TCNGQGQVVT EKCDSCGGRG QNQVSKKLQI KIPAGVDTGT RLRVSNEGDA       240
     GQKGGPPGDL YVYLFVQEDS EFRRDGTNVL SEFKISYLQA ILGAQLPVKT VDGEETITIP       300
     AGTQPGTVLT LENHGVPRLG NPVSRGDHLI TVIIDIPNRI STEERELLVQ LASIRAEQTG       360
     KGGIEGFLGG IFGR                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page