(data stored in ACNUC27125 zone)

EMBL: CP000828.FABZ

CP000828.FABZ        Location/Qualifiers
FT   CDS             complement(572352..572822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="AM1_0584"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25635"
FT                   /db_xref="GOA:B0CD44"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CD44"
FT                   /protein_id="ABW25635.1"
FT                   /translation="MSNPSDGSTDPKTTFMIEEIQELLPHRYPFLLVDRIIDYKESERA
FT                   VGIKNVTMNEEFFQGHFPGRPLMPGVLIVEAMAQVGGIVLAQLPDIPSGKLFVFTGIDK
FT                   VRIRRSVVPGDQLVITAEFLSLKRKRFAMMSTKAEVDGKLACSGELMFAMVD"
     MSNPSDGSTD PKTTFMIEEI QELLPHRYPF LLVDRIIDYK ESERAVGIKN VTMNEEFFQG        60
     HFPGRPLMPG VLIVEAMAQV GGIVLAQLPD IPSGKLFVFT GIDKVRIRRS VVPGDQLVIT       120
     AEFLSLKRKR FAMMSTKAEV DGKLACSGEL MFAMVD                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page