(data stored in ACNUC27125 zone)

EMBL: CP000828.FEOB

CP000828.FEOB        Location/Qualifiers
FT   CDS             complement(453944..456304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="AM1_0473"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25529"
FT                   /db_xref="GOA:B0CBY7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBY7"
FT                   /protein_id="ABW25529.1"
FT                   /translation="MSTPTIALIGNPNCGKTTLFNDLTGTNQRTGNWPGVTVDQKTGHY
FT                   HYNGTKTTVVDLPGVYSLDGEDDSTGLDEVIARDYLLSTEADLILNIVDASNLERNLYL
FT                   TTQIMEMGLPMVVALNMMDIAQDHDLDIDAQVLSQRIGCPVSTMSAFLGEGIHEIKDII
FT                   NSYVDDPKNHPTFVTYPAVIEDAIHQLEPIVQQQGHNSKIAPRWTALKLLEYENRVAPE
FT                   LQGQQLEQIIAKHRRQVHQLLHEDIDILVADTRYGYIRSLMQAAVQQTHQVSHSKSDQI
FT                   DQVVLNRWIGIPLFLVVMYLMFFIAINIGGAFIDFFDIAVGTLFVDAPQTWLESIGTPG
FT                   WLTGIIIAAGSGIQTVATFIPQIGLLFLILALLEDSGYMARAAFVMDKLMRFVGLPGKS
FT                   FIPMLVGFGCNVPAIMATRTLENRRDRLMTIMMNPFMSCGARLPVYALFAAAFFPRNGQ
FT                   NLVFGLYLIGIAAAVFTGFVMKNTIMQGEASPLVMELPPYHIPKIKGVFLRAGDRLKTF
FT                   LLKAGKMIVLMVMVLAFLNSVGTDGSFGQQDSQNSVLSASSRTITPMFAPMGVQAENWP
FT                   ATVGIFTGVFAKEAMVGSLDSLYGQLAEEAAPSEADPPFNLGENLQAAFVSIPTNIVSL
FT                   GNQLLDPLGLNVGDVQDQSAVAEEQELSTSTFGQMAQRFGTSTAAFAYLLFVLMYFPCV
FT                   AATGAVYRETNLGWTALVAAWTTGLAYWVATMFYQMATFAQHPGFSTVWIGGGVVVMVA
FT                   VIGLLKSFGTQRNTISISPIKSTNRPKVTAGRR"
     MSTPTIALIG NPNCGKTTLF NDLTGTNQRT GNWPGVTVDQ KTGHYHYNGT KTTVVDLPGV        60
     YSLDGEDDST GLDEVIARDY LLSTEADLIL NIVDASNLER NLYLTTQIME MGLPMVVALN       120
     MMDIAQDHDL DIDAQVLSQR IGCPVSTMSA FLGEGIHEIK DIINSYVDDP KNHPTFVTYP       180
     AVIEDAIHQL EPIVQQQGHN SKIAPRWTAL KLLEYENRVA PELQGQQLEQ IIAKHRRQVH       240
     QLLHEDIDIL VADTRYGYIR SLMQAAVQQT HQVSHSKSDQ IDQVVLNRWI GIPLFLVVMY       300
     LMFFIAINIG GAFIDFFDIA VGTLFVDAPQ TWLESIGTPG WLTGIIIAAG SGIQTVATFI       360
     PQIGLLFLIL ALLEDSGYMA RAAFVMDKLM RFVGLPGKSF IPMLVGFGCN VPAIMATRTL       420
     ENRRDRLMTI MMNPFMSCGA RLPVYALFAA AFFPRNGQNL VFGLYLIGIA AAVFTGFVMK       480
     NTIMQGEASP LVMELPPYHI PKIKGVFLRA GDRLKTFLLK AGKMIVLMVM VLAFLNSVGT       540
     DGSFGQQDSQ NSVLSASSRT ITPMFAPMGV QAENWPATVG IFTGVFAKEA MVGSLDSLYG       600
     QLAEEAAPSE ADPPFNLGEN LQAAFVSIPT NIVSLGNQLL DPLGLNVGDV QDQSAVAEEQ       660
     ELSTSTFGQM AQRFGTSTAA FAYLLFVLMY FPCVAATGAV YRETNLGWTA LVAAWTTGLA       720
     YWVATMFYQM ATFAQHPGFS TVWIGGGVVV MVAVIGLLKS FGTQRNTISI SPIKSTNRPK       780
     VTAGRR                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page