(data stored in ACNUC27125 zone)

EMBL: CP000828.HSDR

CP000828.HSDR        Location/Qualifiers
FT   CDS             complement(658202..661609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="AM1_0672"
FT                   /product="type I restriction enzyme R protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25721"
FT                   /db_xref="GOA:B0CE87"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE87"
FT                   /protein_id="ABW25721.1"
FT                   /translation="MTNFAFLPSQFRTIAESATRAEGYINSDPRTACFHSRFALEALVH
FT                   WLYRHERSLHMPYDNKLSALLHEPSFQNLVPQVLFHKAKLIKNIGNDAVHNPRPIHQKD
FT                   ALQAVKELHHICYWLTRTYTPDAPRNGAAWNDDRVPTPIDSTQVVPRQELATLEEKLAK
FT                   QHEATLKQQQERDKLDTELQALQQQLAEIRAANEQQPDPHDYTEAETRHYLIDLDLKRA
FT                   GWPLDQKRDREYQVTGMPTSKGTHTGTGYADYVLWGDDGNPLAVVEAKKSTVNPAIGQQ
FT                   QAKLYADCLEAMHNQRPLIFYTNGYTTWLWDDTVYPAHQVVGFYKKDELTRLIRRRTQR
FT                   QSLDTAQIKDEIVDRYYQKRAIGSIFEQFTQARRKALLVMATGTGKTRTAIALVDVLQR
FT                   AGWVKRALFLADRVSLVKQAASSFKKNLPDSSPVNLVTEKDTDGRVYVCTYPTMMGLID
FT                   QTEDHKARFGVGHFDLVIIDEAHRSVYQKYRAIFQHFDSLLVGLTATPREEIDKNTYDL
FT                   FDLEPGVPTDAYELETAVADGFLVPPRVEQVDLRFPREGIDYDTLSDDEKAQWESLDWG
FT                   DDADSSGTLPDRVNAAAVNSWLFNKDTVDKVLKYLMEHGHKVEGGDRLAKTIIFARNHD
FT                   HAKFIEERFNHHYPHHAGHFARIIDNYAKYPQSLIDDFSIKDKAPHIAISVDMLDTGID
FT                   VPEVANLVFFKPVYSKIKFWQMIGRGTRLCEHLFGPDQDKQDFRIFDFCFNFDFFREQP
FT                   EGITSSGSAPLSTRLFRARVQLLGYVNANPELDPDIALKGSLTDQLYGEVAAMNPENFM
FT                   VRMHLEAVEKFQQRQTWDQINDSDREVLTQEIAGLPNDLEIDDIESRLFDLKLLRMQLA
FT                   QTEGDAATFERHRQRVVEMALLIEEKTTIPAVAAQLEYLNRIQEASFWEAIDLNDLEEL
FT                   RLRLRGLTPFLDKKKRKIVYTDFQDEIIRVREQDVVYMPKMTGVQYEKKVKAYLRNHQD
FT                   YLVIQRLRTNKPLTDTDLQGLEAALAEIGADEGETLLSNLLTRSNAPSLAHFIRSLVGM
FT                   DRKTAQAAFSHFLNDRSLTPPQIRFIEMVIDQLTAQGIVEASALYEPPFSNLHAGGPDE
FT                   LFQGQETIIDGIFETLASIHSGLVSTAS"
     MTNFAFLPSQ FRTIAESATR AEGYINSDPR TACFHSRFAL EALVHWLYRH ERSLHMPYDN        60
     KLSALLHEPS FQNLVPQVLF HKAKLIKNIG NDAVHNPRPI HQKDALQAVK ELHHICYWLT       120
     RTYTPDAPRN GAAWNDDRVP TPIDSTQVVP RQELATLEEK LAKQHEATLK QQQERDKLDT       180
     ELQALQQQLA EIRAANEQQP DPHDYTEAET RHYLIDLDLK RAGWPLDQKR DREYQVTGMP       240
     TSKGTHTGTG YADYVLWGDD GNPLAVVEAK KSTVNPAIGQ QQAKLYADCL EAMHNQRPLI       300
     FYTNGYTTWL WDDTVYPAHQ VVGFYKKDEL TRLIRRRTQR QSLDTAQIKD EIVDRYYQKR       360
     AIGSIFEQFT QARRKALLVM ATGTGKTRTA IALVDVLQRA GWVKRALFLA DRVSLVKQAA       420
     SSFKKNLPDS SPVNLVTEKD TDGRVYVCTY PTMMGLIDQT EDHKARFGVG HFDLVIIDEA       480
     HRSVYQKYRA IFQHFDSLLV GLTATPREEI DKNTYDLFDL EPGVPTDAYE LETAVADGFL       540
     VPPRVEQVDL RFPREGIDYD TLSDDEKAQW ESLDWGDDAD SSGTLPDRVN AAAVNSWLFN       600
     KDTVDKVLKY LMEHGHKVEG GDRLAKTIIF ARNHDHAKFI EERFNHHYPH HAGHFARIID       660
     NYAKYPQSLI DDFSIKDKAP HIAISVDMLD TGIDVPEVAN LVFFKPVYSK IKFWQMIGRG       720
     TRLCEHLFGP DQDKQDFRIF DFCFNFDFFR EQPEGITSSG SAPLSTRLFR ARVQLLGYVN       780
     ANPELDPDIA LKGSLTDQLY GEVAAMNPEN FMVRMHLEAV EKFQQRQTWD QINDSDREVL       840
     TQEIAGLPND LEIDDIESRL FDLKLLRMQL AQTEGDAATF ERHRQRVVEM ALLIEEKTTI       900
     PAVAAQLEYL NRIQEASFWE AIDLNDLEEL RLRLRGLTPF LDKKKRKIVY TDFQDEIIRV       960
     REQDVVYMPK MTGVQYEKKV KAYLRNHQDY LVIQRLRTNK PLTDTDLQGL EAALAEIGAD      1020
     EGETLLSNLL TRSNAPSLAH FIRSLVGMDR KTAQAAFSHF LNDRSLTPPQ IRFIEMVIDQ      1080
     LTAQGIVEAS ALYEPPFSNL HAGGPDELFQ GQETIIDGIF ETLASIHSGL VSTAS           1135
//

If you have problems or comments...

PBIL Back to PBIL home page