(data stored in ACNUC27125 zone)

EMBL: CP000828.LPXA

CP000828.LPXA        Location/Qualifiers
FT   CDS             complement(569906..570721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="AM1_0583"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25633"
FT                   /db_xref="GOA:B0CD42"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD42"
FT                   /protein_id="ABW25633.1"
FT                   /translation="MTDLIHPTAVIHPQATLHQTVQIGAYAVIGKQVKLGPGTQVGHHA
FT                   VIEGWTEIGADNHIFPGVVIGMEPQDRNFRGEQSGVKICDRNQIREYVTIHRASGDQQF
FT                   TTIGSDNLLMANVHIGHNCHIADRVVIANSVALSGHVQVESQANISGVLGIHQFVHVGQ
FT                   LAMIGGMSRITRDVPPLMLVEGNPAHVRALNQVGLQRHGVYDLLQGEMRGLLKQAFRYL
FT                   YRSNLQLEVALDQVESLSEHPLIQHLCQFMRAAQTRRGLTPGRQRWASV"
     MTDLIHPTAV IHPQATLHQT VQIGAYAVIG KQVKLGPGTQ VGHHAVIEGW TEIGADNHIF        60
     PGVVIGMEPQ DRNFRGEQSG VKICDRNQIR EYVTIHRASG DQQFTTIGSD NLLMANVHIG       120
     HNCHIADRVV IANSVALSGH VQVESQANIS GVLGIHQFVH VGQLAMIGGM SRITRDVPPL       180
     MLVEGNPAHV RALNQVGLQR HGVYDLLQGE MRGLLKQAFR YLYRSNLQLE VALDQVESLS       240
     EHPLIQHLCQ FMRAAQTRRG LTPGRQRWAS V                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page