(data stored in ACNUC27125 zone)

EMBL: CP000828.LYSC

CP000828.LYSC        Location/Qualifiers
FT   CDS             747149..748921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="AM1_0770"
FT                   /product="asparate kinase, monofunctional class"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25814"
FT                   /db_xref="GOA:B0CFC7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFC7"
FT                   /protein_id="ABW25814.1"
FT                   /translation="MGLIVQKFGGTSVGSVERIKAVAQRVKQTVAQGNSVVVVVSAMGK
FT                   STDTLVQLAQEVSSNPCRREMDMLLSTGEQVSISLLSMALQALGQPAISLTGAQVGIVT
FT                   EPEHTRARILHIATERLERHLEEGKVVVVAGFQGTSNTSDLEVTTLGRGGSDTSAVALA
FT                   AALHAEKCEIYTDVAGVLTTDPRLVEKAQLMTEITCEEMLELASLGANVLHPRAVEIAR
FT                   NYGVQMAVRSSWTDEPGTQIISTGTQPKTLTDLELGRPVDAVHFDLNQAKVALLHVADR
FT                   PGVAAGLFGELANQGLDVDLIIQSIHDGNSNDIAFTVAQDCCVQAEAVANAFNSTVPSG
FT                   STSEVLVEPNVAKVSIVGAGIIGRPQIAAQMFQTLSDLGINLQMISTSEVNVSCTITAA
FT                   DCERATKALCDVFEVTSSSIDSGISLPDYPIPPVRGVALDLEQAQLAIRNVPDRPGMAA
FT                   HIFQVLAKRNISVDMIIQSQRSRQVEGQITRDIAFTVAEGDLEVAKGLLQDLSRNLGCG
FT                   EVASDSAIAKVSIVGIGMLGQPGVAAQMFMALAQQKINIQMIATSEIRVSCVVAQGDGS
FT                   TALQAIHQAFGLEG"
     MGLIVQKFGG TSVGSVERIK AVAQRVKQTV AQGNSVVVVV SAMGKSTDTL VQLAQEVSSN        60
     PCRREMDMLL STGEQVSISL LSMALQALGQ PAISLTGAQV GIVTEPEHTR ARILHIATER       120
     LERHLEEGKV VVVAGFQGTS NTSDLEVTTL GRGGSDTSAV ALAAALHAEK CEIYTDVAGV       180
     LTTDPRLVEK AQLMTEITCE EMLELASLGA NVLHPRAVEI ARNYGVQMAV RSSWTDEPGT       240
     QIISTGTQPK TLTDLELGRP VDAVHFDLNQ AKVALLHVAD RPGVAAGLFG ELANQGLDVD       300
     LIIQSIHDGN SNDIAFTVAQ DCCVQAEAVA NAFNSTVPSG STSEVLVEPN VAKVSIVGAG       360
     IIGRPQIAAQ MFQTLSDLGI NLQMISTSEV NVSCTITAAD CERATKALCD VFEVTSSSID       420
     SGISLPDYPI PPVRGVALDL EQAQLAIRNV PDRPGMAAHI FQVLAKRNIS VDMIIQSQRS       480
     RQVEGQITRD IAFTVAEGDL EVAKGLLQDL SRNLGCGEVA SDSAIAKVSI VGIGMLGQPG       540
     VAAQMFMALA QQKINIQMIA TSEIRVSCVV AQGDGSTALQ AIHQAFGLEG                  590
//

If you have problems or comments...

PBIL Back to PBIL home page