(data stored in ACNUC8465 zone)

EMBL: CP000828.NBLB

CP000828.NBLB        Location/Qualifiers
FT   CDS             44143..44808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nblB"
FT                   /locus_tag="AM1_0043"
FT                   /product="PBS lyase HEAT repeat NblB-like protein"
FT                   /note="PBS lyase HEAT-like repeat (COG1413) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25131"
FT                   /db_xref="GOA:B0C519"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B0C519"
FT                   /protein_id="ABW25131.1"
FT                   /translation="MPHPRLQELTLKLKSENASDRLLALVALRSLPSAETFPLIKPMLF
FT                   DDYLPVRSMAIRSLIHHPSAESVSLLVQLLDDPNYEIRAGAAGALGHVGDHDIVQALSR
FT                   VFLEDTEWLVCFSAAVSLGNLKDPGAYAVLLHALDHPETIVQQAAIAALGEIKAFDALE
FT                   SLLPFVQAEDWMIRKSLATTLGNLPGPKSISALKYLAKDDNPQVAAAATVALELIHEP"
     MPHPRLQELT LKLKSENASD RLLALVALRS LPSAETFPLI KPMLFDDYLP VRSMAIRSLI        60
     HHPSAESVSL LVQLLDDPNY EIRAGAAGAL GHVGDHDIVQ ALSRVFLEDT EWLVCFSAAV       120
     SLGNLKDPGA YAVLLHALDH PETIVQQAAI AALGEIKAFD ALESLLPFVQ AEDWMIRKSL       180
     ATTLGNLPGP KSISALKYLA KDDNPQVAAA ATVALELIHE P                           221
//

If you have problems or comments...

PBIL Back to PBIL home page