(data stored in ACNUC5340 zone)

EMBL: CP000828.NRDG

CP000828.NRDG        Location/Qualifiers
FT   CDS             436139..436762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="AM1_0457"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="class III (anaerobic) ribonucleotide reductase:
FT                   activating protein for anaerobic ribonucleotide
FT                   triphosphate reductase (NrdG)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25513"
FT                   /db_xref="GOA:B0CB23"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB23"
FT                   /protein_id="ABW25513.1"
FT                   /translation="MNTQNNLPPKALLDIPPGYLNIMGYVDESEVNGPGCRAVIWMQGC
FT                   HRACPGCFNPDSWSFEINQLIDVKSLVQNVLSNPRHEGVTFSGGEPFWQAPALIELAHQ
FT                   VKAAGLNVMSFTGFTLAQLQADSAPVGAQNLLDQLDILIDGPYIEVLKIHSPDSPVASS
FT                   NQQVHIFNPSLQDKITWASDQLEIHIQPDGSRTFTGYHGQLLGS"
     MNTQNNLPPK ALLDIPPGYL NIMGYVDESE VNGPGCRAVI WMQGCHRACP GCFNPDSWSF        60
     EINQLIDVKS LVQNVLSNPR HEGVTFSGGE PFWQAPALIE LAHQVKAAGL NVMSFTGFTL       120
     AQLQADSAPV GAQNLLDQLD ILIDGPYIEV LKIHSPDSPV ASSNQQVHIF NPSLQDKITW       180
     ASDQLEIHIQ PDGSRTFTGY HGQLLGS                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page