(data stored in ACNUC27125 zone)

EMBL: CP000828.PDHB

CP000828.PDHB        Location/Qualifiers
FT   CDS             complement(677247..678230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="AM1_0696"
FT                   /product="pyruvate dehydrogenase E1 component beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25742"
FT                   /db_xref="GOA:B0CEA8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEA8"
FT                   /protein_id="ABW25742.1"
FT                   /translation="MAEVLLFNALRDAIDEEMANDNTVMVMGEDVGHYGGSYKVTKGLY
FT                   DKYGELRVLDTPIAENSFTGMAVGAAMTGLKPIIEGMNMGFLLLAFNQIANNAGMLRYT
FT                   SGGNFKIPMVIRGPGGVGRQLGAEHSQRLEAYFQAVPGLKIVACSTPYNAKGLLKAAIR
FT                   DPNPVLFFEHVLLYNLKEELPDQEYVLPLDKAEVVRSGKDVTILTYSRMRHHVVQAAKT
FT                   LTEQGYDPEIIDLISLKPLDFDTIGASIRKTHRVIVVEECMRTGGVGAEIIASINDRFF
FT                   DELDAPVVRLSSQDIPTPYNGMLESLTIVQPPQIVEAVQQITALQV"
     MAEVLLFNAL RDAIDEEMAN DNTVMVMGED VGHYGGSYKV TKGLYDKYGE LRVLDTPIAE        60
     NSFTGMAVGA AMTGLKPIIE GMNMGFLLLA FNQIANNAGM LRYTSGGNFK IPMVIRGPGG       120
     VGRQLGAEHS QRLEAYFQAV PGLKIVACST PYNAKGLLKA AIRDPNPVLF FEHVLLYNLK       180
     EELPDQEYVL PLDKAEVVRS GKDVTILTYS RMRHHVVQAA KTLTEQGYDP EIIDLISLKP       240
     LDFDTIGASI RKTHRVIVVE ECMRTGGVGA EIIASINDRF FDELDAPVVR LSSQDIPTPY       300
     NGMLESLTIV QPPQIVEAVQ QITALQV                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page