(data stored in ACNUC8465 zone)

EMBL: CP000828.PE100

CP000828.PE100       Location/Qualifiers
FT   CDS             complement(105735..105851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25191"
FT                   /db_xref="UniProtKB/TrEMBL:B0C697"
FT                   /protein_id="ABW25191.1"
FT                   /translation="MVFIPKYCQKCIYSNSGASWGNIHELARHQESVIEKAS"
     MVFIPKYCQK CIYSNSGASW GNIHELARHQ ESVIEKAS                                38
//

If you have problems or comments...

PBIL Back to PBIL home page