(data stored in ACNUC5340 zone)

EMBL: CP000828.PE101

CP000828.PE101       Location/Qualifiers
FT   CDS             106076..108868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0104"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25192"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B0C698"
FT                   /protein_id="ABW25192.1"
FT                   /translation="MHRFYRWAHWPTLSSLLILGLSCYPLSLASAAPTDSQQFADWCNN
FT                   SAQLKPSQRATISALLKQLDTTDCQQAEQLLKANPGLSLQGQEISDLSPLATLPHLTNL
FT                   NLTDNQIKDLSPLSHLPNLNFLLAGRNQIEDVSPLAKLPNLSYVVLDLNQIKDVSMLKP
FT                   LQKLTALNVLSNPIQKKLCPVAPSSICLFSDEAQDQFAAAEQQYQQGNLRLALQSFQTL
FT                   QSTYQQNSDRHKLGDTLNRLGDIHQQLGNYPKALTTYEQAFQLRQEITDESGIVVSLTS
FT                   LASVYERLALYAKAQDLLQQASVSLRNQNPFRLDGGGVYEHAKEEALLYGWQARLFIRQ
FT                   GQQAKAIKALDKAQGLFDNIPPAFPNKRFHERLIRETRGAALLGLGQTDAALTVLQSAL
FT                   EVATEIEDQAGMASTLNLLGKAYRQKGNEKQALKVFRQALSIHQSIENQPGVGLTQHNM
FT                   GETWLQSKDYAKASKALAKAVDIWESLRPGLTDANKVSLFETQVITYSYLQTALIALEK
FT                   PDQALEVAERGRARAFVELLASRIGADSSSQFQQPNPPTIDQIRNIARSQKATLVEYSL
FT                   LPEQLLIWVITPDGLVSLRPVDLKELSEQSQQSLPQMVAEARQAMEMGAGTDVMSLSLD
FT                   GLPVAQSPDHLRQLHQILIDPIADLLPKNPDERVIFIPYRELFMVPFPALEGEDGPLIA
FT                   RHTMLTAPSIQLLHYTKQRRQQLQQSPQKALVVGNPDMPHISPGVDLPAEPLLPLPGAE
FT                   QEAVKIASLLDTSALTGSDATEALVTERMAKAPVIHLATHGLLEELKHLGFSIPGAIAL
FT                   TPSAKLNDGLLTTSEILNLDLQAELVVLSACNTGVGTITGDGVIGLSRALMASGAPSLI
FT                   VSLWAVPDAPTANLMTEFYTRWQQNPDKAQALRHAMLKTREQHPDPRDWAAFSLMGQAE
FT                   "
     MHRFYRWAHW PTLSSLLILG LSCYPLSLAS AAPTDSQQFA DWCNNSAQLK PSQRATISAL        60
     LKQLDTTDCQ QAEQLLKANP GLSLQGQEIS DLSPLATLPH LTNLNLTDNQ IKDLSPLSHL       120
     PNLNFLLAGR NQIEDVSPLA KLPNLSYVVL DLNQIKDVSM LKPLQKLTAL NVLSNPIQKK       180
     LCPVAPSSIC LFSDEAQDQF AAAEQQYQQG NLRLALQSFQ TLQSTYQQNS DRHKLGDTLN       240
     RLGDIHQQLG NYPKALTTYE QAFQLRQEIT DESGIVVSLT SLASVYERLA LYAKAQDLLQ       300
     QASVSLRNQN PFRLDGGGVY EHAKEEALLY GWQARLFIRQ GQQAKAIKAL DKAQGLFDNI       360
     PPAFPNKRFH ERLIRETRGA ALLGLGQTDA ALTVLQSALE VATEIEDQAG MASTLNLLGK       420
     AYRQKGNEKQ ALKVFRQALS IHQSIENQPG VGLTQHNMGE TWLQSKDYAK ASKALAKAVD       480
     IWESLRPGLT DANKVSLFET QVITYSYLQT ALIALEKPDQ ALEVAERGRA RAFVELLASR       540
     IGADSSSQFQ QPNPPTIDQI RNIARSQKAT LVEYSLLPEQ LLIWVITPDG LVSLRPVDLK       600
     ELSEQSQQSL PQMVAEARQA MEMGAGTDVM SLSLDGLPVA QSPDHLRQLH QILIDPIADL       660
     LPKNPDERVI FIPYRELFMV PFPALEGEDG PLIARHTMLT APSIQLLHYT KQRRQQLQQS       720
     PQKALVVGNP DMPHISPGVD LPAEPLLPLP GAEQEAVKIA SLLDTSALTG SDATEALVTE       780
     RMAKAPVIHL ATHGLLEELK HLGFSIPGAI ALTPSAKLND GLLTTSEILN LDLQAELVVL       840
     SACNTGVGTI TGDGVIGLSR ALMASGAPSL IVSLWAVPDA PTANLMTEFY TRWQQNPDKA       900
     QALRHAMLKT REQHPDPRDW AAFSLMGQAE                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page