(data stored in ACNUC8465 zone)

EMBL: CP000828.PE110

CP000828.PE110       Location/Qualifiers
FT   CDS             120126..120743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0114"
FT                   /product="glutaredoxin-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25201"
FT                   /db_xref="GOA:B0C6A7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6A7"
FT                   /protein_id="ABW25201.1"
FT                   /translation="MSGHEVNITLYRWAGAWGPFKVKIPCGECTLTKDVILDTLENELA
FT                   GIPVILEIREWLTEWWKPLLKGGWHAPIVMVNGKVISQGHALNRGLLTEAVTAAYASKA
FT                   PIQRSHLFGKESCPHCKRAKAYLDQVGIQYTYHDVVRSPRALYEMLARVKPLVGPKTPI
FT                   TVPQIWLGGQYIGGADRLEQVMQEQGLFRPEFNTVKTTLQPR"
     MSGHEVNITL YRWAGAWGPF KVKIPCGECT LTKDVILDTL ENELAGIPVI LEIREWLTEW        60
     WKPLLKGGWH APIVMVNGKV ISQGHALNRG LLTEAVTAAY ASKAPIQRSH LFGKESCPHC       120
     KRAKAYLDQV GIQYTYHDVV RSPRALYEML ARVKPLVGPK TPITVPQIWL GGQYIGGADR       180
     LEQVMQEQGL FRPEFNTVKT TLQPR                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page