(data stored in ACNUC27125 zone)

EMBL: CP000828.PE111

CP000828.PE111       Location/Qualifiers
FT   CDS             120878..121663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25202"
FT                   /db_xref="InterPro:IPR041261"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6A8"
FT                   /protein_id="ABW25202.1"
FT                   /translation="MNSLVSLSMPTITKAFIQELGNGKLETEEQLVAEALTQKGIPFSF
FT                   FTAKRIRRRQLPLDEHSLVVGNIPCILGALKQLNIPTPALNDYPVCLQSFLHRQIWQST
FT                   LSELATRLERGDYPAIFAKPCSRRKQFTGAIFQSEVDLAQVSGISKHENLICSEVVHWR
FT                   SEYRVYVVRSQIRGIHHYEGDPLEPIDRDAVEEAIRILNESGEAYAGYAIDFGVLDSGK
FT                   TALIEMNDGFAVGAYGVSAQDYTDMVWSRWEELLSQMAT"
     MNSLVSLSMP TITKAFIQEL GNGKLETEEQ LVAEALTQKG IPFSFFTAKR IRRRQLPLDE        60
     HSLVVGNIPC ILGALKQLNI PTPALNDYPV CLQSFLHRQI WQSTLSELAT RLERGDYPAI       120
     FAKPCSRRKQ FTGAIFQSEV DLAQVSGISK HENLICSEVV HWRSEYRVYV VRSQIRGIHH       180
     YEGDPLEPID RDAVEEAIRI LNESGEAYAG YAIDFGVLDS GKTALIEMND GFAVGAYGVS       240
     AQDYTDMVWS RWEELLSQMA T                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page