(data stored in ACNUC8465 zone)

EMBL: CP000828.PE114

CP000828.PE114       Location/Qualifiers
FT   CDS             122949..123353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25205"
FT                   /db_xref="GOA:B0C6B1"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6B1"
FT                   /protein_id="ABW25205.1"
FT                   /translation="MSHQTTPITRVVIAHTLISALHGLAHLLIPVPISVLQALFIAGVI
FT                   SALPIVAVVLVWRQQVKWASTVLLVSMAGSLLFGLYNHFVVISPDHFSQMPPTSLGVLF
FT                   QVTAILLAVSEGIGIGVSVWALNPRQPLIP"
     MSHQTTPITR VVIAHTLISA LHGLAHLLIP VPISVLQALF IAGVISALPI VAVVLVWRQQ        60
     VKWASTVLLV SMAGSLLFGL YNHFVVISPD HFSQMPPTSL GVLFQVTAIL LAVSEGIGIG       120
     VSVWALNPRQ PLIP                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page