(data stored in ACNUC27125 zone)

EMBL: CP000828.PE116

CP000828.PE116       Location/Qualifiers
FT   CDS             124424..124681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25207"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6B3"
FT                   /protein_id="ABW25207.1"
FT                   /translation="MTDLHIKALDLAREGKWHEAHHLVERQSDQTSCLIHGYLHRVEGD
FT                   ISNAKYWYRRAGEGMPDNTLAEELRCLYKVAKSAKKRQRQ"
     MTDLHIKALD LAREGKWHEA HHLVERQSDQ TSCLIHGYLH RVEGDISNAK YWYRRAGEGM        60
     PDNTLAEELR CLYKVAKSAK KRQRQ                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page