(data stored in ACNUC5340 zone)

EMBL: CP000828.PE119

CP000828.PE119       Location/Qualifiers
FT   CDS             125606..126058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25210"
FT                   /db_xref="InterPro:IPR024755"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6B6"
FT                   /protein_id="ABW25210.1"
FT                   /translation="MSGGQTGADRAALDWAMVMEIEHGGWCPQGRRAEDGIIPTCYHLQ
FT                   ETPSSAYAQRTEWNIRDSDATVILSLSSLLGGGTLLTQQLAQQIEKPWIHLHAGMGIQN
FT                   GAAHLHQFVSQFSIKVLNIAGPRQSEEPTIGEFLTQVMNTAFTRND"
     MSGGQTGADR AALDWAMVME IEHGGWCPQG RRAEDGIIPT CYHLQETPSS AYAQRTEWNI        60
     RDSDATVILS LSSLLGGGTL LTQQLAQQIE KPWIHLHAGM GIQNGAAHLH QFVSQFSIKV       120
     LNIAGPRQSE EPTIGEFLTQ VMNTAFTRND                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page