(data stored in ACNUC8465 zone)

EMBL: CP000828.PE120

CP000828.PE120       Location/Qualifiers
FT   CDS             126078..126566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25211"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6B7"
FT                   /protein_id="ABW25211.1"
FT                   /translation="MHHVHVKIVIRADQQTVFQAISDHEKFLNRPEVKCQLIKEGSDSI
FT                   NGCGAIREVTLSWGTFQEEVTVFQAPNHFEYKIRSFSNTQGESGSFQHDRGWLDFSSEN
FT                   EGTQIDWHTRFEIPSPMGQSIIEWLAGWRTQRMFMKLLHQVKTKLEDSPIVDTIAGLF"
     MHHVHVKIVI RADQQTVFQA ISDHEKFLNR PEVKCQLIKE GSDSINGCGA IREVTLSWGT        60
     FQEEVTVFQA PNHFEYKIRS FSNTQGESGS FQHDRGWLDF SSENEGTQID WHTRFEIPSP       120
     MGQSIIEWLA GWRTQRMFMK LLHQVKTKLE DSPIVDTIAG LF                          162
//

If you have problems or comments...

PBIL Back to PBIL home page