(data stored in ACNUC5340 zone)

EMBL: CP000828.PE13

CP000828.PE13        Location/Qualifiers
FT   CDS             complement(12895..14004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25104"
FT                   /db_xref="GOA:B0C4Z2"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Z2"
FT                   /protein_id="ABW25104.1"
FT                   /translation="MTGLSQRTREQGSRLKGLEFLSALIVVAGGITTCVTQNMVLAAAP
FT                   LSVAVALNLHNRRQMDRLTEYYAGLRRNTIQIALRQDLQVIQAYVSLHQRNNTESELAQ
FT                   FHQSIDALLDEIKRLEARQKGGVDAKKLPIFLDQIEGLKEQVQNCGQTLMALMQDLQEI
FT                   STPTARLAAMSALKTTLQRYQNTPRSIDQNPKVAELVRDWCGEVQSLQAQLDTLTSSMN
FT                   QKNSSDLATSQGESLSCLYEQSSSLDHRLVSIQKVLSEQLLPFNTDQQNLQRSLHQLQE
FT                   EMARLHPDLNSVKSSTSDTALSPIQIEEQIVVALTPLQVQYVSLVNDLELLEVDMQGLV
FT                   YQARQLRHIQRQLLAIHQQMQWITQIDGD"
     MTGLSQRTRE QGSRLKGLEF LSALIVVAGG ITTCVTQNMV LAAAPLSVAV ALNLHNRRQM        60
     DRLTEYYAGL RRNTIQIALR QDLQVIQAYV SLHQRNNTES ELAQFHQSID ALLDEIKRLE       120
     ARQKGGVDAK KLPIFLDQIE GLKEQVQNCG QTLMALMQDL QEISTPTARL AAMSALKTTL       180
     QRYQNTPRSI DQNPKVAELV RDWCGEVQSL QAQLDTLTSS MNQKNSSDLA TSQGESLSCL       240
     YEQSSSLDHR LVSIQKVLSE QLLPFNTDQQ NLQRSLHQLQ EEMARLHPDL NSVKSSTSDT       300
     ALSPIQIEEQ IVVALTPLQV QYVSLVNDLE LLEVDMQGLV YQARQLRHIQ RQLLAIHQQM       360
     QWITQIDGD                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page