(data stored in ACNUC8465 zone)

EMBL: CP000828.PE132

CP000828.PE132       Location/Qualifiers
FT   CDS             complement(135628..136488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0137"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Putative multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25223"
FT                   /db_xref="GOA:B0C6C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6C9"
FT                   /protein_id="ABW25223.1"
FT                   /translation="MNSSVSLQNISKIYNQVSVVNDLSLAIQSGEIFGLLGPNGAGKST
FT                   TIRMMTTLTKPSQGNIQIAGLDIDQGQQIKRKIGVVLQQVSLDQDLTVWENMEMHGRLH
FT                   HLPKSLRQDRIHHYLDYVDLLQRQQDVVRQLSGGMMRRLQIARALLHQPQILFLDEPTV
FT                   GLDPQSRRRIWEIIQELNHQGMTIVLTTHYMEEVESLCDRIGIIDKGQLIALGTLAELK
FT                   QQHGDGLLVKQVGESSRPQWDYQFFPTLAAAQDYLDHQTNRVGMMVRPANLEDIFVELT
FT                   GRNLD"
     MNSSVSLQNI SKIYNQVSVV NDLSLAIQSG EIFGLLGPNG AGKSTTIRMM TTLTKPSQGN        60
     IQIAGLDIDQ GQQIKRKIGV VLQQVSLDQD LTVWENMEMH GRLHHLPKSL RQDRIHHYLD       120
     YVDLLQRQQD VVRQLSGGMM RRLQIARALL HQPQILFLDE PTVGLDPQSR RRIWEIIQEL       180
     NHQGMTIVLT THYMEEVESL CDRIGIIDKG QLIALGTLAE LKQQHGDGLL VKQVGESSRP       240
     QWDYQFFPTL AAAQDYLDHQ TNRVGMMVRP ANLEDIFVEL TGRNLD                      286
//

If you have problems or comments...

PBIL Back to PBIL home page