(data stored in ACNUC8465 zone)

EMBL: CP000828.PE133

CP000828.PE133       Location/Qualifiers
FT   CDS             136591..136791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25224"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6D0"
FT                   /protein_id="ABW25224.1"
FT                   /translation="MAKRRNLKKEKALRNQAYARKFRKRSGSGRFGRRQYNSNRQESNS
FT                   DNQNGDNQDSNNSSDTATASD"
     MAKRRNLKKE KALRNQAYAR KFRKRSGSGR FGRRQYNSNR QESNSDNQNG DNQDSNNSSD        60
     TATASD                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page