(data stored in ACNUC27125 zone)

EMBL: CP000828.PE138

CP000828.PE138       Location/Qualifiers
FT   CDS             142246..143259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25229"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6D5"
FT                   /protein_id="ABW25229.1"
FT                   /translation="MSNYRFSHAQKYAIWLRHGKRCYVCTEPLRLVEVTIDHVIPERLL
FT                   NDDVERDRVFGEYGLDGSTFQINGYENWLPAHYRCNQEKSGSIFEFVPAIKLRLSRLSK
FT                   LGPSVQKTAERVLADARTQRALANVLDAVATGNLTNEERETLLAELRDVGTADTDVIES
FT                   ELLVRPNPSAERLQILAAEFESLEEFKRSLYSISLQINESDEGDTSRRVGEFLSGKINL
FT                   AHLYSHYLPPNVRNAINAGSDAQMRVQQTRMAGKVPAGYEDRGLPIQFTTDAEQKIISN
FT                   AAVKWGVSEQEAESVYRVIALLVQECQTAMQDALRLVHEALDNRLIAIRAERNEII"
     MSNYRFSHAQ KYAIWLRHGK RCYVCTEPLR LVEVTIDHVI PERLLNDDVE RDRVFGEYGL        60
     DGSTFQINGY ENWLPAHYRC NQEKSGSIFE FVPAIKLRLS RLSKLGPSVQ KTAERVLADA       120
     RTQRALANVL DAVATGNLTN EERETLLAEL RDVGTADTDV IESELLVRPN PSAERLQILA       180
     AEFESLEEFK RSLYSISLQI NESDEGDTSR RVGEFLSGKI NLAHLYSHYL PPNVRNAINA       240
     GSDAQMRVQQ TRMAGKVPAG YEDRGLPIQF TTDAEQKIIS NAAVKWGVSE QEAESVYRVI       300
     ALLVQECQTA MQDALRLVHE ALDNRLIAIR AERNEII                                337
//

If you have problems or comments...

PBIL Back to PBIL home page