(data stored in ACNUC27125 zone)

EMBL: CP000828.PE139

CP000828.PE139       Location/Qualifiers
FT   CDS             complement(143439..144713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25230"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6D6"
FT                   /protein_id="ABW25230.1"
FT                   /translation="MATTQRSEQNQSVPKQPQRSRDWSWPYWPFVPLYPYGQRRTLCRE
FT                   IVKGKIWTFEQLQGILYVIIPVRMTVIKLAAGGLLVYAPVAPTRECIRMVKDLIEKHGE
FT                   IKYIILPTASGIEHKVFTGPFSKRFPKAQVFVSPSQWTFPLNIPLSWLGLSGRQTQKLP
FT                   ANSADTPFADEFDYAILGPVDLGLGPFEEVALYHKPTKTLLITDSIVSIPVNPPQVLQF
FT                   APYPMLFHAKDNAFDVVEDTPTIRRKGWQRMALFAFYFQPSVLDVVNTKQTFKDARQAP
FT                   DRSKKAYFGLFPVQWHPDWKRAFDTFRQDGNPVVAPILRKLIFNRNPEVVLQWADRVAQ
FT                   WNFRRIIPCHLDAPVMTTPQKFNQAFDFLRSAPPPQRGWFAKKQPISVNFPKEDMAFLD
FT                   RVDQFLCDRNITPPAKPLPRETSEQ"
     MATTQRSEQN QSVPKQPQRS RDWSWPYWPF VPLYPYGQRR TLCREIVKGK IWTFEQLQGI        60
     LYVIIPVRMT VIKLAAGGLL VYAPVAPTRE CIRMVKDLIE KHGEIKYIIL PTASGIEHKV       120
     FTGPFSKRFP KAQVFVSPSQ WTFPLNIPLS WLGLSGRQTQ KLPANSADTP FADEFDYAIL       180
     GPVDLGLGPF EEVALYHKPT KTLLITDSIV SIPVNPPQVL QFAPYPMLFH AKDNAFDVVE       240
     DTPTIRRKGW QRMALFAFYF QPSVLDVVNT KQTFKDARQA PDRSKKAYFG LFPVQWHPDW       300
     KRAFDTFRQD GNPVVAPILR KLIFNRNPEV VLQWADRVAQ WNFRRIIPCH LDAPVMTTPQ       360
     KFNQAFDFLR SAPPPQRGWF AKKQPISVNF PKEDMAFLDR VDQFLCDRNI TPPAKPLPRE       420
     TSEQ                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page