(data stored in ACNUC5340 zone)

EMBL: CP000828.PE145

CP000828.PE145       Location/Qualifiers
FT   CDS             complement(149264..150814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25236"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6E2"
FT                   /protein_id="ABW25236.1"
FT                   /translation="MLLKSCGLFLGLIVAGSGDAIATPNDLQSLDRGHRILIQRGLQLN
FT                   ALTIGFTIKGRENDSELWQNWEASNFTTLDIGRGQLASSETIAGQKPWSTWQANAQDSA
FT                   QSLPDRIFQSDQIQNLVSWQFKDEQDIGKESELQELETWIKHYRPLLPNTLLYTNQHGD
FT                   ERFGGFGSTSDLNIQRYMRRIQPDLLMQDTYPYGIWNDLGNQGGRPAQLYYAMMRYRRL
FT                   ALAGNDGTGRKPIPYGLWLQTFKGSATGVGTWSRFPSESELSQQQFAALTLGFKLLNAF
FT                   TYNGTSDVGGKLNAPFFKQPFGKDPTPAFQHIAEINQHSLNLGPTLVRLLSTDVRIVPR
FT                   PPTLADLIAPEIPHWDAKADPYMTSLEVKNLGNLYGGRNGDVLVGYFKPLRESFDGPAT
FT                   NQQYFMLTNGLAGKRHSIEQTRQQLTVEFDFGESEITGLQRLNRKTGKVESIQAGWREE
FT                   VASGLTSQFDVLGDHKYRLTLILDGGTGDLFKFGTGAPFVGQSTVQQSIQTSSKSGEN"
     MLLKSCGLFL GLIVAGSGDA IATPNDLQSL DRGHRILIQR GLQLNALTIG FTIKGRENDS        60
     ELWQNWEASN FTTLDIGRGQ LASSETIAGQ KPWSTWQANA QDSAQSLPDR IFQSDQIQNL       120
     VSWQFKDEQD IGKESELQEL ETWIKHYRPL LPNTLLYTNQ HGDERFGGFG STSDLNIQRY       180
     MRRIQPDLLM QDTYPYGIWN DLGNQGGRPA QLYYAMMRYR RLALAGNDGT GRKPIPYGLW       240
     LQTFKGSATG VGTWSRFPSE SELSQQQFAA LTLGFKLLNA FTYNGTSDVG GKLNAPFFKQ       300
     PFGKDPTPAF QHIAEINQHS LNLGPTLVRL LSTDVRIVPR PPTLADLIAP EIPHWDAKAD       360
     PYMTSLEVKN LGNLYGGRNG DVLVGYFKPL RESFDGPATN QQYFMLTNGL AGKRHSIEQT       420
     RQQLTVEFDF GESEITGLQR LNRKTGKVES IQAGWREEVA SGLTSQFDVL GDHKYRLTLI       480
     LDGGTGDLFK FGTGAPFVGQ STVQQSIQTS SKSGEN                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page