(data stored in ACNUC27125 zone)

EMBL: CP000828.PE15

CP000828.PE15        Location/Qualifiers
FT   CDS             complement(16489..18813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0017"
FT                   /product="sensor histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25106"
FT                   /db_xref="GOA:B0C4Z4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Z4"
FT                   /protein_id="ABW25106.1"
FT                   /translation="MFIQTLRSFPGKLARRHKLRTVLVVPFVLQVCGAVGLVGYLSFQN
FT                   GQRSIESLAQQLTDEVEVHIAERTQTYLAAPHAVNQLNQNALELGQLSADNLNSMERHF
FT                   WRQIQVFDRISYIQFGTPKGEFVGLAANDDGSFTYQVTEYSGDLQTYAIKQNGQRGKKL
FT                   ETSPNFEPQKRPWYLIPEKKDKPTWTDIYAWVNPPTLAITLGQPYYDQSGTFQGILATD
FT                   LSIAQFSDFLQTLKIGKTGKSFILERSGLMVATSTAEEPFTPSEKGPQRLPALESKDPV
FT                   VRATTQTLLDRFGTLQEISVRQQLTIDIEGKRYFLQVNPLRDQHGLDWLSVVVVPEADF
FT                   MEQIYANTRSTIGLSVAALLFAILIGVSTARWVTNPILKINAAATAISSGDLQRSVALN
FT                   RSDELGELARSFNQMVQDLRISLEERNVVVEALKKSEQQLAEYNRSLEQEVQQRTQELV
FT                   QSEKMVALGQLTAGVAHEINTPLGAIQAAGENIASSLEKSMQQLPKILDQLQPEQTDAF
FT                   FELLAMAQQQELLTSREERKLKRSLKKILAEKSLEPANDMASTLSKMGVSADLSSFLPI
FT                   LELPNNTEVLDVAYDLTVIHNNTQNIRLAVGRAAKIVFALKSYARQDLSNEKVKASVTD
FT                   TVETVLTLYHNQIKHGIDLTKDFEDVPDILCYPEELAQVWTNLLHNAMQAMDYKGHIQL
FT                   TIGQEQQGILVSFTDSGSGIPEDVQAKIFDPFFTTKPAGEGSGLGLDIVRKIVDKHQGK
FT                   VECQSQPGHTRFEVWLPLEVS"
     MFIQTLRSFP GKLARRHKLR TVLVVPFVLQ VCGAVGLVGY LSFQNGQRSI ESLAQQLTDE        60
     VEVHIAERTQ TYLAAPHAVN QLNQNALELG QLSADNLNSM ERHFWRQIQV FDRISYIQFG       120
     TPKGEFVGLA ANDDGSFTYQ VTEYSGDLQT YAIKQNGQRG KKLETSPNFE PQKRPWYLIP       180
     EKKDKPTWTD IYAWVNPPTL AITLGQPYYD QSGTFQGILA TDLSIAQFSD FLQTLKIGKT       240
     GKSFILERSG LMVATSTAEE PFTPSEKGPQ RLPALESKDP VVRATTQTLL DRFGTLQEIS       300
     VRQQLTIDIE GKRYFLQVNP LRDQHGLDWL SVVVVPEADF MEQIYANTRS TIGLSVAALL       360
     FAILIGVSTA RWVTNPILKI NAAATAISSG DLQRSVALNR SDELGELARS FNQMVQDLRI       420
     SLEERNVVVE ALKKSEQQLA EYNRSLEQEV QQRTQELVQS EKMVALGQLT AGVAHEINTP       480
     LGAIQAAGEN IASSLEKSMQ QLPKILDQLQ PEQTDAFFEL LAMAQQQELL TSREERKLKR       540
     SLKKILAEKS LEPANDMAST LSKMGVSADL SSFLPILELP NNTEVLDVAY DLTVIHNNTQ       600
     NIRLAVGRAA KIVFALKSYA RQDLSNEKVK ASVTDTVETV LTLYHNQIKH GIDLTKDFED       660
     VPDILCYPEE LAQVWTNLLH NAMQAMDYKG HIQLTIGQEQ QGILVSFTDS GSGIPEDVQA       720
     KIFDPFFTTK PAGEGSGLGL DIVRKIVDKH QGKVECQSQP GHTRFEVWLP LEVS             774
//

If you have problems or comments...

PBIL Back to PBIL home page