(data stored in ACNUC8465 zone)

EMBL: CP000828.PE150

CP000828.PE150       Location/Qualifiers
FT   CDS             complement(154418..155077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0155"
FT                   /product="ion transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25241"
FT                   /db_xref="GOA:B0C6E7"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6E7"
FT                   /protein_id="ABW25241.1"
FT                   /translation="MKITCLQSLTNHKYTQLLLTLLLLFVAYAVVGAIAAEVILSLILL
FT                   IAIVLIVRTFFLQKRAFYFYIVIAGLAFISDCFYILFTQSSYHRLIPALIADSVYIGFL
FT                   ILSIILMLHKLFENNNVTIDTIVGGICVFLLIGDLWFLFYSSIHLFHPDAFSSARETIQ
FT                   TFDLLYFSFTTLTTVGYGDVVPVSQLAKVVANFEAIVGVIYPAIFISRLVGGYNPD"
     MKITCLQSLT NHKYTQLLLT LLLLFVAYAV VGAIAAEVIL SLILLIAIVL IVRTFFLQKR        60
     AFYFYIVIAG LAFISDCFYI LFTQSSYHRL IPALIADSVY IGFLILSIIL MLHKLFENNN       120
     VTIDTIVGGI CVFLLIGDLW FLFYSSIHLF HPDAFSSARE TIQTFDLLYF SFTTLTTVGY       180
     GDVVPVSQLA KVVANFEAIV GVIYPAIFIS RLVGGYNPD                              219
//

If you have problems or comments...

PBIL Back to PBIL home page