(data stored in ACNUC8465 zone)

EMBL: CP000828.PE154

CP000828.PE154       Location/Qualifiers
FT   CDS             complement(157185..158675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0159"
FT                   /product="rieske 2Fe-2S domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25245"
FT                   /db_xref="GOA:B0C7I5"
FT                   /db_xref="InterPro:IPR013626"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7I5"
FT                   /protein_id="ABW25245.1"
FT                   /translation="MTTDIDLNPENLKGLELQPTAEGQPFNWLKQWYPVSPLSYLDDSC
FT                   PTPITLLGKNLVIWQHQGQWIAMDDVCPHKLTQLSLGKVQADGTLVCRQHGWCFDQQGQ
FT                   CVQNPMLPAQLDQPAAYHNVRSHVTTYPTQVEQGLLWIWPDRNDRAFADCQQKQPATLP
FT                   KTSPKWNKTDWHMIEVPLGYTVSIENSFDPVHAQFLHEGIGTFSPANAIPMQGFELLGE
FT                   LSAEEGFVLSHKGYNTFNREMEATRTFRPPCANITQYYLPTGGVQTFQLYFVPTAPEHC
FT                   RYIMKFVMDLEFPARPLSLIQWMNKQMLGLLPEYVQVGLQHLGTYKLNDQDITAMHAQE
FT                   RNEAVIDTGRRRSPFLPSPADQGTLTLKNWLNRFGSGGPEPNSLYAERVESRSNEQLYD
FT                   RWHRHTKLCPSCRRSVEWIAEVQRVCHFMTTMMAILGGIMLLLPLTTRPSLGCFAIAIL
FT                   SLLGHQGLTKLHSHFMSSIPGQGIPSVRLWPTGSARNL"
     MTTDIDLNPE NLKGLELQPT AEGQPFNWLK QWYPVSPLSY LDDSCPTPIT LLGKNLVIWQ        60
     HQGQWIAMDD VCPHKLTQLS LGKVQADGTL VCRQHGWCFD QQGQCVQNPM LPAQLDQPAA       120
     YHNVRSHVTT YPTQVEQGLL WIWPDRNDRA FADCQQKQPA TLPKTSPKWN KTDWHMIEVP       180
     LGYTVSIENS FDPVHAQFLH EGIGTFSPAN AIPMQGFELL GELSAEEGFV LSHKGYNTFN       240
     REMEATRTFR PPCANITQYY LPTGGVQTFQ LYFVPTAPEH CRYIMKFVMD LEFPARPLSL       300
     IQWMNKQMLG LLPEYVQVGL QHLGTYKLND QDITAMHAQE RNEAVIDTGR RRSPFLPSPA       360
     DQGTLTLKNW LNRFGSGGPE PNSLYAERVE SRSNEQLYDR WHRHTKLCPS CRRSVEWIAE       420
     VQRVCHFMTT MMAILGGIML LLPLTTRPSL GCFAIAILSL LGHQGLTKLH SHFMSSIPGQ       480
     GIPSVRLWPT GSARNL                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page