(data stored in ACNUC27125 zone)

EMBL: CP000828.PE155

CP000828.PE155       Location/Qualifiers
FT   CDS             158975..160084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25246"
FT                   /db_xref="GOA:A8ZM09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM09"
FT                   /protein_id="ABW25246.1"
FT                   /translation="MVERFGTLGVSPHLSSTPMIKIDFTAEEIQQLNYERYHHPHPRVQ
FT                   RRMEVLYLKSQGLSHTQICQLCQISRPTLAKTLRQYQQGGIEGLKTLEYKGQPSLLNAH
FT                   SDSVRAYFEQHPPRTSAEAQAVIEQLTGIKRSPTQIKAFLKRIGCRYRKVGYVPGKSSL
FT                   PEKIEEQEQFRHTRLEPLLEEAQRQERLVFFVDAAHFVHRAYLGFVWCITRIFIPSPSG
FT                   RQRFNVLGALDAITKDLVSVTNHTYINSHSMCLLLAKLALLDPVIPISVILDNARYQKC
FT                   QLVTDFAEIVDIELVYLPSYSPHLNLIERLWRFVRKECLYSKYYADFPAFKGAIQQCID
FT                   QCNGEHKAKLTTLLSLKFQSFKKVNILAA"
     MVERFGTLGV SPHLSSTPMI KIDFTAEEIQ QLNYERYHHP HPRVQRRMEV LYLKSQGLSH        60
     TQICQLCQIS RPTLAKTLRQ YQQGGIEGLK TLEYKGQPSL LNAHSDSVRA YFEQHPPRTS       120
     AEAQAVIEQL TGIKRSPTQI KAFLKRIGCR YRKVGYVPGK SSLPEKIEEQ EQFRHTRLEP       180
     LLEEAQRQER LVFFVDAAHF VHRAYLGFVW CITRIFIPSP SGRQRFNVLG ALDAITKDLV       240
     SVTNHTYINS HSMCLLLAKL ALLDPVIPIS VILDNARYQK CQLVTDFAEI VDIELVYLPS       300
     YSPHLNLIER LWRFVRKECL YSKYYADFPA FKGAIQQCID QCNGEHKAKL TTLLSLKFQS       360
     FKKVNILAA                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page