(data stored in ACNUC5340 zone)

EMBL: CP000828.PE159

CP000828.PE159       Location/Qualifiers
FT   CDS             complement(163392..163829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25250"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J0"
FT                   /protein_id="ABW25250.1"
FT                   /translation="MFSFSIALLIILNLEKIMTTSSPITPVSEETRALVNQKMANESDE
FT                   IKQKAGELVDLIKKRAESELSAADQITRETYHQAISQAKATLNQTETFFQEQGNALDQS
FT                   LKELNDDASRKWDTFVAELKGMGDRFDKAVNSAWAALIKES"
     MFSFSIALLI ILNLEKIMTT SSPITPVSEE TRALVNQKMA NESDEIKQKA GELVDLIKKR        60
     AESELSAADQ ITRETYHQAI SQAKATLNQT ETFFQEQGNA LDQSLKELND DASRKWDTFV       120
     AELKGMGDRF DKAVNSAWAA LIKES                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page