(data stored in ACNUC27125 zone)

EMBL: CP000828.PE160

CP000828.PE160       Location/Qualifiers
FT   CDS             164176..167778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0165"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25251"
FT                   /db_xref="GOA:B0C7J1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J1"
FT                   /protein_id="ABW25251.1"
FT                   /translation="MIAVDALAVLEKTLPPGTLNQVKTLVFKQAWDGKGYAEIAEEAGY
FT                   DTDYIKSVAAQLWKSISSELGEKVTKTNFRSLLIQRLDKSDVSEDSLVQPPIAEDSTPL
FT                   PSGIANEKAPVVDWGEAPDVSKFYGRNEELAQISTCNLTEGCRLVAVLGMGGMGKTSLI
FT                   AKLAQQVQHHYDFVIWRSLRNAPTADEVIAELIPFLSEQQSDQCSTRQLVQCLRASKCL
FT                   IIFDNLESILQAGQVGYYRPGYEEYGNLLRVVGETAHQSCLLLTSREKPPEVAELEGLD
FT                   LAVRSFSLRGSSEVATALLNAKGIEGSPEQQQQLSHHYGGSPLALKIIASSIQDLFEGN
FT                   LEDFLAQETVAFNGIRRLLDQQFKRLSPLEKVILNWLAINREWTSIAELQRDIVPTVSM
FT                   ASLLESLEALTWRNLIEKNVSRQGQSGQYTLQPVVMEYVTNDLVQQVYQDLMEDTDSQG
FT                   VQRQGLTSSQSYFHTHALLKTTVKDYIQDSQKRLILEPLAQLLRNTFFSAPMLAQWVQS
FT                   VLNQLHTSPVTGYGPGNLINLCRQLKLDLTGYDFSQLPIWQANLRDMSLPQVNFKGANF
FT                   QQTLFTQSLSGILNIAYSPKGDFLATIDATGSVRLWQVADGQLHMSFEDHSYWGWALAF
FT                   SPDGQQLASGGEDNMVRVWDVTTGQCINSLELKCNVVWTVAFSPNGQTLAIGTSDTDIL
FT                   LWDLERNQLPEVLQGHTSDVRSLQFSPDGQQLVSASHDHTLKIWNLQSGKCQQTCVGHS
FT                   EWVLSVAYSIDGQTLASGSADRTVRLWDVKTGQCRQTLSGHDLMVTAIAFSPDGQHIAS
FT                   ASEDRTVRVWDVRGQHLKTLVGHLHWVWSVAFSPDGQMLASGGSDQTVRFWHVQTGRPL
FT                   KTLAGYIDYSYALAWLPDGQALLSGSSNHTIRTWEQGRCRQTWKAHENWVWSVSCRPDG
FT                   QVLASGSNAVKLWDMETNACIATLQEDEGFVFCLAWSPNGRYFATGSSDHRVRIWKADT
FT                   QRCLQLLEGHEGWVFQVAWSPNGQSLASCGVDGTANVWNIKTGDCLQTFHEDNWIWSVV
FT                   WSPDHRFLAYSTADGNIKFWDTKTWKLLQTLTGHTAQVTRIDFSPSGRRLASGSYDLTI
FT                   KIWDVETGNCQQTLTGHTQIITNLVFNPVETDNSCLLASASEDETLRIWNILSGECQHV
FT                   LRPEGPYEGMNVADTSGLTPAQIKSLQSLGAVTG"
     MIAVDALAVL EKTLPPGTLN QVKTLVFKQA WDGKGYAEIA EEAGYDTDYI KSVAAQLWKS        60
     ISSELGEKVT KTNFRSLLIQ RLDKSDVSED SLVQPPIAED STPLPSGIAN EKAPVVDWGE       120
     APDVSKFYGR NEELAQISTC NLTEGCRLVA VLGMGGMGKT SLIAKLAQQV QHHYDFVIWR       180
     SLRNAPTADE VIAELIPFLS EQQSDQCSTR QLVQCLRASK CLIIFDNLES ILQAGQVGYY       240
     RPGYEEYGNL LRVVGETAHQ SCLLLTSREK PPEVAELEGL DLAVRSFSLR GSSEVATALL       300
     NAKGIEGSPE QQQQLSHHYG GSPLALKIIA SSIQDLFEGN LEDFLAQETV AFNGIRRLLD       360
     QQFKRLSPLE KVILNWLAIN REWTSIAELQ RDIVPTVSMA SLLESLEALT WRNLIEKNVS       420
     RQGQSGQYTL QPVVMEYVTN DLVQQVYQDL MEDTDSQGVQ RQGLTSSQSY FHTHALLKTT       480
     VKDYIQDSQK RLILEPLAQL LRNTFFSAPM LAQWVQSVLN QLHTSPVTGY GPGNLINLCR       540
     QLKLDLTGYD FSQLPIWQAN LRDMSLPQVN FKGANFQQTL FTQSLSGILN IAYSPKGDFL       600
     ATIDATGSVR LWQVADGQLH MSFEDHSYWG WALAFSPDGQ QLASGGEDNM VRVWDVTTGQ       660
     CINSLELKCN VVWTVAFSPN GQTLAIGTSD TDILLWDLER NQLPEVLQGH TSDVRSLQFS       720
     PDGQQLVSAS HDHTLKIWNL QSGKCQQTCV GHSEWVLSVA YSIDGQTLAS GSADRTVRLW       780
     DVKTGQCRQT LSGHDLMVTA IAFSPDGQHI ASASEDRTVR VWDVRGQHLK TLVGHLHWVW       840
     SVAFSPDGQM LASGGSDQTV RFWHVQTGRP LKTLAGYIDY SYALAWLPDG QALLSGSSNH       900
     TIRTWEQGRC RQTWKAHENW VWSVSCRPDG QVLASGSNAV KLWDMETNAC IATLQEDEGF       960
     VFCLAWSPNG RYFATGSSDH RVRIWKADTQ RCLQLLEGHE GWVFQVAWSP NGQSLASCGV      1020
     DGTANVWNIK TGDCLQTFHE DNWIWSVVWS PDHRFLAYST ADGNIKFWDT KTWKLLQTLT      1080
     GHTAQVTRID FSPSGRRLAS GSYDLTIKIW DVETGNCQQT LTGHTQIITN LVFNPVETDN      1140
     SCLLASASED ETLRIWNILS GECQHVLRPE GPYEGMNVAD TSGLTPAQIK SLQSLGAVTG      1200
//

If you have problems or comments...

PBIL Back to PBIL home page