(data stored in ACNUC27125 zone)

EMBL: CP000828.PE161

CP000828.PE161       Location/Qualifiers
FT   CDS             complement(167846..168511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25252"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J2"
FT                   /protein_id="ABW25252.1"
FT                   /translation="MTPRPLPVLPDSPKPPEIERLKPEQKPGSKDQTTEKQDPKDSESQ
FT                   SSDSEPKNDSDLNAKNQETDTPPAPPIESEEVETIFGELDQALINSEVESDFDYIPGPE
FT                   EFPEPEKFFTPESIKAFDFKNPKLAALGAIINSPRYYRLKEPDEVLASFPTIPAFKSAS
FT                   QPKKIGEYGGGPVYEFKVDDKTYYVSLVKSVKKLSKATFVIFWRADPNNLSKPDQGTS"
     MTPRPLPVLP DSPKPPEIER LKPEQKPGSK DQTTEKQDPK DSESQSSDSE PKNDSDLNAK        60
     NQETDTPPAP PIESEEVETI FGELDQALIN SEVESDFDYI PGPEEFPEPE KFFTPESIKA       120
     FDFKNPKLAA LGAIINSPRY YRLKEPDEVL ASFPTIPAFK SASQPKKIGE YGGGPVYEFK       180
     VDDKTYYVSL VKSVKKLSKA TFVIFWRADP NNLSKPDQGT S                           221
//

If you have problems or comments...

PBIL Back to PBIL home page