(data stored in ACNUC5340 zone)

EMBL: CP000828.PE165

CP000828.PE165       Location/Qualifiers
FT   CDS             complement(170571..170981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0170"
FT                   /product="biopolymer transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25256"
FT                   /db_xref="GOA:B0C7J6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J6"
FT                   /protein_id="ABW25256.1"
FT                   /translation="MKFAQQESTIPEINLIPMLNVMMGILAFFVMITMTLSKQKSLEVQ
FT                   LPQEAGGQQEIKLSDLKNQFVVDLDNQGQASRDKQSISDKELQAKVRQYLLDNPKGNVF
FT                   LKPNPKLTYEKMMHKLDLMRAAGGERVSLIIE"
     MKFAQQESTI PEINLIPMLN VMMGILAFFV MITMTLSKQK SLEVQLPQEA GGQQEIKLSD        60
     LKNQFVVDLD NQGQASRDKQ SISDKELQAK VRQYLLDNPK GNVFLKPNPK LTYEKMMHKL       120
     DLMRAAGGER VSLIIE                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page