(data stored in ACNUC5340 zone)

EMBL: CP000828.PE175

CP000828.PE175       Location/Qualifiers
FT   CDS             complement(184336..184878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25266"
FT                   /db_xref="GOA:B0C7K6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K6"
FT                   /protein_id="ABW25266.1"
FT                   /translation="MSQTLTLPSPTAPTLQSTFPQTETYFITLCTHERECLFGEIIAGE
FT                   MQLNDLGALVAEEWQISFDQSSDFDLHHWVMMPNHIHGIIGAANPSSQDLAQQPLMQET
FT                   KVRSHSLLKWISSFKGMASQRIKHLRNLPHQPLWQQEVDQHIIPHRFAFHTFHQYITTN
FT                   PHAWDWDKLHPDSPALS"
     MSQTLTLPSP TAPTLQSTFP QTETYFITLC THERECLFGE IIAGEMQLND LGALVAEEWQ        60
     ISFDQSSDFD LHHWVMMPNH IHGIIGAANP SSQDLAQQPL MQETKVRSHS LLKWISSFKG       120
     MASQRIKHLR NLPHQPLWQQ EVDQHIIPHR FAFHTFHQYI TTNPHAWDWD KLHPDSPALS       180
//

If you have problems or comments...

PBIL Back to PBIL home page