(data stored in ACNUC5340 zone)

EMBL: CP000828.PE177

CP000828.PE177       Location/Qualifiers
FT   CDS             complement(185998..186726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0181"
FT                   /product="DnaJ-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25268"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K8"
FT                   /protein_id="ABW25268.1"
FT                   /translation="MDIADCYRLLQLTSRANIEDLKASYRRLARQWHPDTNPGDQLAHE
FT                   KFIQVTEAYKTLQKIVPPAPNNSTVPASVPSRATAKPRSAPSVKVSTQSTKPSSPPPPQ
FT                   QPQRQARPQAATSRPRATVSKQPTPQPKPATSTRKSSLSPADIKLKVDSYKQLQELIQR
FT                   QRFPRAVALIEALAQRLPQDAEVRQWQAIIYQSWGRQLIRERKLNQARAYLKKALNTDP
FT                   HNKALWAEIELDFKKIEMAF"
     MDIADCYRLL QLTSRANIED LKASYRRLAR QWHPDTNPGD QLAHEKFIQV TEAYKTLQKI        60
     VPPAPNNSTV PASVPSRATA KPRSAPSVKV STQSTKPSSP PPPQQPQRQA RPQAATSRPR       120
     ATVSKQPTPQ PKPATSTRKS SLSPADIKLK VDSYKQLQEL IQRQRFPRAV ALIEALAQRL       180
     PQDAEVRQWQ AIIYQSWGRQ LIRERKLNQA RAYLKKALNT DPHNKALWAE IELDFKKIEM       240
     AF                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page