(data stored in ACNUC8465 zone)

EMBL: CP000828.PE178

CP000828.PE178       Location/Qualifiers
FT   CDS             187124..187498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0183"
FT                   /product="STAS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25269"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K9"
FT                   /protein_id="ABW25269.1"
FT                   /translation="MQQLPSFCIVHPPQHLTSTTQDVFYQHIYELVQSRVEVILINLET
FT                   VTRLDSGGLGILFGAFRISHRQGKRLMLYSPQSHVVQNLHKTGLTQIVGTYATLADCIK
FT                   DAIPYSHRWVQDLSIQLPEF"
     MQQLPSFCIV HPPQHLTSTT QDVFYQHIYE LVQSRVEVIL INLETVTRLD SGGLGILFGA        60
     FRISHRQGKR LMLYSPQSHV VQNLHKTGLT QIVGTYATLA DCIKDAIPYS HRWVQDLSIQ       120
     LPEF                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page