(data stored in ACNUC5340 zone)

EMBL: CP000828.PE179

CP000828.PE179       Location/Qualifiers
FT   CDS             complement(187549..188475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25270"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7L0"
FT                   /protein_id="ABW25270.1"
FT                   /translation="MHPSFNLKLSLLGVLTLTQLLGCQTGVKPSSLTPTQCEQGGDFVW
FT                   IEGGDYILGSDRQERDYAYRISAAASAQQPEQRAKAEARLRKRGWFDGEPNRQVRSQPS
FT                   VCMGKNLITNAEYQAFVKATGHRSPFISADDYQKQGFLVHPYLSVKPFLWQGQRFPTGK
FT                   GQHPVVLVSYPDAQAFAQWRGQQDGQSYRLPTALEWEQAARGTDGRYFPWGNDWQADAT
FT                   NWANHGGLQTSAIATYPLSRSPAGVEDMAGNVFEYTSTLTQQVIRSAVVMKGCSWDDSP
FT                   GFCRAAYQHSRSQNSRHILFGFRLVKE"
     MHPSFNLKLS LLGVLTLTQL LGCQTGVKPS SLTPTQCEQG GDFVWIEGGD YILGSDRQER        60
     DYAYRISAAA SAQQPEQRAK AEARLRKRGW FDGEPNRQVR SQPSVCMGKN LITNAEYQAF       120
     VKATGHRSPF ISADDYQKQG FLVHPYLSVK PFLWQGQRFP TGKGQHPVVL VSYPDAQAFA       180
     QWRGQQDGQS YRLPTALEWE QAARGTDGRY FPWGNDWQAD ATNWANHGGL QTSAIATYPL       240
     SRSPAGVEDM AGNVFEYTST LTQQVIRSAV VMKGCSWDDS PGFCRAAYQH SRSQNSRHIL       300
     FGFRLVKE                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page